powered by:
Protein Alignment CG42323 and C17H11.2
DIOPT Version :9
Sequence 1: | NP_001138219.1 |
Gene: | CG42323 / 32825 |
FlyBaseID: | FBgn0259223 |
Length: | 259 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509378.1 |
Gene: | C17H11.2 / 181074 |
WormBaseID: | WBGene00015922 |
Length: | 738 |
Species: | Caenorhabditis elegans |
Alignment Length: | 51 |
Identity: | 13/51 - (25%) |
Similarity: | 21/51 - (41%) |
Gaps: | 1/51 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 PAAYSISAPSVDHASVGSTQEHTVKGHYGQSSQSDYASQVQTAHSQSHVQR 75
|......||..|.....::||:|.......||..| :|.:....:||.:.:
Worm 333 PEDDGFEAPDEDLLQEVTSQENTASPETAPSSSED-SSPMVDEETQSSIDK 382
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2E2SE |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.