powered by:
Protein Alignment CG42323 and C17H11.2
DIOPT Version :9
| Sequence 1: | NP_001138219.1 |
Gene: | CG42323 / 32825 |
FlyBaseID: | FBgn0259223 |
Length: | 259 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_509378.1 |
Gene: | C17H11.2 / 181074 |
WormBaseID: | WBGene00015922 |
Length: | 738 |
Species: | Caenorhabditis elegans |
| Alignment Length: | 51 |
Identity: | 13/51 - (25%) |
| Similarity: | 21/51 - (41%) |
Gaps: | 1/51 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 25 PAAYSISAPSVDHASVGSTQEHTVKGHYGQSSQSDYASQVQTAHSQSHVQR 75
|......||..|.....::||:|.......||..| :|.:....:||.:.:
Worm 333 PEDDGFEAPDEDLLQEVTSQENTASPETAPSSSED-SSPMVDEETQSSIDK 382
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_2E2SE |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.
