DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and GRR1

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_012623.1 Gene:GRR1 / 853552 SGDID:S000003850 Length:1151 Species:Saccharomyces cerevisiae


Alignment Length:462 Identity:94/462 - (20%)
Similarity:167/462 - (36%) Gaps:158/462 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFISFSVISRFDFFW---LDVLKQLDLK---------SR--ISFAASCDMFENI---YVRSSP-- 47
            |||          .|   :|..:..|||         ||  |:...|....:||   ..|.||  
Yeast   261 NFI----------IWINSIDTTESSDLKEGLQDLSRYSRQFINNVLSNPSNQNICTSVTRRSPVF 315

  Fly    48 -----------LRLSRVVNLEEMIEFSLLETKLFVELSGSDIEIIRGGPHTPMFSHFEDFIRLMS 101
                       |.|.::....::::| |..:||:.|:.   ::|:...||....|..:.|:|.|.
Yeast   316 ALNMLPSEILHLILDKLNQKYDIVKF-LTVSKLWAEII---VKILYYRPHINKKSQLDLFLRTMK 376

  Fly   102 IRLTKVNEIALEGFQLTQYKWFNAPETSFS--------NLTYVS--LRRCQLNDENLVGWEFLTH 156
            :                     .:.||.|:        |.::|.  :...:||  ..||.:   :
Yeast   377 L---------------------TSEETVFNYRLMIKRLNFSFVGDYMHDTELN--YFVGCK---N 415

  Fly   157 LETLDLRYNDRLTGSCLMSLPTS--------LLSLYITGCRNL-----------CPNQLIFLNRI 202
            ||.|.|.:...:|     |:|.|        |.|:.|||.|::           ||....|.  :
Yeast   416 LERLTLVFCKHIT-----SVPISAVLRGCKFLQSVDITGIRDVSDDVFDTLATYCPRVQGFY--V 473

  Fly   203 PRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAHSTDT 267
            |:.|.:....|         |:.::..|:|..::|:..:...||                     
Yeast   474 PQARNVTFDSL---------RNFIVHSPMLKRIKITANNNMNDE--------------------- 508

  Fly   268 IRCKVSDWMLISLL--DVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLR 330
                     |:.||  ..|.|..:..:.:|: ...::.|.:::|..|||..::.:.....::|.:
Yeast   509 ---------LVELLANKCPLLVEVDITLSPN-VTDSSLLKLLTRLVQLREFRITHNTNITDNLFQ 563

  Fly   331 -----LRNLTFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLLTNRVYLDAELASKKRS 390
                 :.::..|..:|||....||::.:..:|...|.|..:.:..|..:|     ||.|....:.
Yeast   564 ELSKVVDDMPSLRLIDLSGCENITDKTIESIVNLAPKLRNVFLGKCSRIT-----DASLFQLSKL 623

  Fly   391 NGNMVKV 397
            ..|:..|
Yeast   624 GKNLQTV 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 5/24 (21%)
leucine-rich repeat 157..179 CDD:275381 7/21 (33%)
leucine-rich repeat 180..204 CDD:275381 9/34 (26%)
leucine-rich repeat 205..231 CDD:275381 3/25 (12%)
leucine-rich repeat 232..285 CDD:275381 7/54 (13%)
leucine-rich repeat 286..326 CDD:275381 7/39 (18%)
AMN1 306..>376 CDD:187754 15/74 (20%)
leucine-rich repeat 337..362 CDD:275381 7/24 (29%)
GRR1NP_012623.1 F-box-like 320..361 CDD:403981 8/44 (18%)
AMN1 404..559 CDD:187754 41/206 (20%)
leucine-rich repeat 416..441 CDD:275381 8/29 (28%)
leucine-rich repeat 442..467 CDD:275381 7/24 (29%)
leucine-rich repeat 494..519 CDD:275381 7/54 (13%)
leucine-rich repeat 520..545 CDD:275381 4/25 (16%)
leucine-rich repeat 546..574 CDD:275381 3/27 (11%)
AMN1 <574..737 CDD:187754 16/62 (26%)
leucine-rich repeat 575..600 CDD:275381 7/24 (29%)
leucine-rich repeat 601..626 CDD:275381 6/29 (21%)
leucine-rich repeat 627..652 CDD:275381 1/4 (25%)
leucine-rich repeat 653..677 CDD:275381
leucine-rich repeat 678..704 CDD:275381
leucine-rich repeat 707..732 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.