DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and AMN1

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_009716.1 Gene:AMN1 / 852455 SGDID:S000000362 Length:549 Species:Saccharomyces cerevisiae


Alignment Length:378 Identity:83/378 - (21%)
Similarity:133/378 - (35%) Gaps:114/378 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SCDMFENIYVRSSPLRLSRVVNLEEMIEFSLLETKLFVELSGSDIEIIRGGPHTPMFSHFEDFIR 98
            ||.|...:::..:...|.:.::.:.:..|     |.|:..|....:::|.       |||     
Yeast   243 SCMMVNRLWLNVTRPFLFKSLHFKSVHNF-----KEFLRTSQETTQVMRP-------SHF----- 290

  Fly    99 LMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRCQLNDENLVGWEF-LTHLETLDL 162
                .|.|::       |:||           .::..:|...||    ||...|| :....|..|
Yeast   291 ----ILHKLH-------QVTQ-----------PDIERLSRMECQ----NLKWLEFYVCPRITPPL 329

  Fly   163 RYNDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLNR-IPRLRE--LRASDLMPGGHWHIYRD 224
            .:.|.|         ..|..|.|.|.:|:..|.|:.|:: ||.|:.  |||.|.:        .|
Yeast   330 SWFDNL---------HKLEKLIIPGNKNIDDNFLLRLSQSIPNLKHLVLRACDNV--------SD 377

  Fly   225 -----LVLACPLLVMVEISICSLNRDEYRLGELRYLQSLVI--KAHSTDTI---RCKVSD---WM 276
                 :.|.||.|.       :.|...:|.|.|....|||.  |....:|:   .|.|.|   |.
Yeast   378 SGVVCIALNCPKLK-------TFNIGRHRRGNLITSVSLVALGKYTQVETVGFAGCDVDDAGIWE 435

  Fly   277 LISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRLRNLTFLETLD 341
            ...|......|           :|.|:..:::.: .|.:|...|.         ..||..||..:
Yeast   436 FARLNGKNVER-----------LSLNSCRLLTDY-SLPILFALNS---------FPNLAVLEIRN 479

  Fly   342 LSNSPYITNEVVIEL---VIGIPNLSVLIVQGCPLLTNRVYLDAELASKKRSN 391
            |.....:.:.|...|   .:..|    ::::.|..:|.  .:|.|....||.|
Yeast   480 LDKITDVRHFVKYNLWKKSLDAP----ILIEACERITK--LIDQEENRVKRIN 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 7/23 (30%)
leucine-rich repeat 157..179 CDD:275381 4/21 (19%)
leucine-rich repeat 180..204 CDD:275381 9/24 (38%)
leucine-rich repeat 205..231 CDD:275381 8/32 (25%)
leucine-rich repeat 232..285 CDD:275381 15/60 (25%)
leucine-rich repeat 286..326 CDD:275381 6/39 (15%)
AMN1 306..>376 CDD:187754 12/72 (17%)
leucine-rich repeat 337..362 CDD:275381 5/27 (19%)
AMN1NP_009716.1 AMN1 285..509 CDD:187754 68/310 (22%)
leucine-rich repeat 314..337 CDD:275381 7/31 (23%)
leucine-rich repeat 338..363 CDD:275381 9/24 (38%)
leucine-rich repeat 364..389 CDD:275381 8/32 (25%)
leucine-rich repeat 390..417 CDD:275381 9/33 (27%)
leucine-rich repeat 418..443 CDD:275381 6/24 (25%)
leucine-rich repeat 444..471 CDD:275381 6/47 (13%)
leucine-rich repeat 472..493 CDD:275381 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.