Sequence 1: | NP_573291.1 | Gene: | CG15056 / 32824 | FlyBaseID: | FBgn0030918 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011537169.1 | Gene: | KDM2B / 84678 | HGNCID: | 13610 | Length: | 1353 | Species: | Homo sapiens |
Alignment Length: | 267 | Identity: | 60/267 - (22%) |
---|---|---|---|
Similarity: | 97/267 - (36%) | Gaps: | 105/267 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 130 FSNLTY----VSLRRCQ-----LNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSL----PTSL- 180
Fly 181 LSLYITGCRNLCPNQLIFL-NRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEIS-ICSLN 243
Fly 244 RDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIIS 308
Fly 309 RFRQLRVLKMP---NQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQG 370
Fly 371 CPLLTNR 377 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15056 | NP_573291.1 | leucine-rich repeat | 133..156 | CDD:275381 | 7/31 (23%) |
leucine-rich repeat | 157..179 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 180..204 | CDD:275381 | 9/25 (36%) | ||
leucine-rich repeat | 205..231 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 232..285 | CDD:275381 | 8/53 (15%) | ||
leucine-rich repeat | 286..326 | CDD:275381 | 9/42 (21%) | ||
AMN1 | 306..>376 | CDD:187754 | 18/72 (25%) | ||
leucine-rich repeat | 337..362 | CDD:275381 | 4/24 (17%) | ||
KDM2B | XP_011537169.1 | JmjC | 182..257 | CDD:214721 | |
cupin_like | 229..335 | CDD:304367 | |||
zf-CXXC | <615..651 | CDD:251032 | |||
PHD_KDM2B | 661..722 | CDD:277114 | |||
F-box-like | 1071..1111 | CDD:289689 | 10/41 (24%) | ||
leucine-rich repeat | 1105..1129 | CDD:275381 | 5/29 (17%) | ||
AMN1 | 1121..1310 | CDD:187754 | 48/215 (22%) | ||
leucine-rich repeat | 1130..1153 | CDD:275381 | 10/27 (37%) | ||
leucine-rich repeat | 1154..1177 | CDD:275381 | 9/72 (13%) | ||
leucine-rich repeat | 1178..1217 | CDD:275381 | 13/57 (23%) | ||
leucine-rich repeat | 1218..1242 | CDD:275381 | 4/27 (15%) | ||
leucine-rich repeat | 1243..1272 | CDD:275381 | 5/15 (33%) | ||
leucine-rich repeat | 1273..1297 | CDD:275381 | |||
leucine-rich repeat | 1298..1323 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |