DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and AT1G80570

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_974191.1 Gene:AT1G80570 / 844396 AraportID:AT1G80570 Length:480 Species:Arabidopsis thaliana


Alignment Length:428 Identity:85/428 - (19%)
Similarity:161/428 - (37%) Gaps:121/428 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WLDVL-KQLDLKSRISFAASCDMFENIYVRSSPLRLS--------RVVNLEEMIEFSLLETKLFV 71
            |:..| ||:|.:..:....:|...       :.|.||        .:.:|....|.|.|:.....
plant    89 WMSKLGKQVDDQGLLVLTTNCHSL-------TDLTLSFCTFITDVGIGHLSSCPELSSLKLNFAP 146

  Fly    72 ELSGSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYV 136
            .::|..:..:..|        .:...||..||.  :|..::|..:     :|...||    |..:
plant   147 RITGCGVLSLAVG--------CKKLRRLHLIRC--LNVASVEWLE-----YFGKLET----LEEL 192

  Fly   137 SLRRCQ-LNDENLV----GWEFLTHLE-TLDLRYN-----DRL-------------------TGS 171
            .::.|: :.:.:|:    .|..||.|: .:|..|.     |:|                   .|:
plant   193 CIKNCRAIGEGDLIKLRNSWRKLTSLQFEVDANYRYMKVYDQLDVERWPKQLVPCDSLVELSLGN 257

  Fly   172 CLMSLPTSLLSLYITGCRNL-------C----PNQLIFLNRIPRLRELRASDLMPGGHWHIYRDL 225
            |::: |...|:..:..|:||       |    .:.:|.|  :.:...||:..|      .:..|.
plant   258 CIIA-PGRGLACVLRNCKNLEKLHLDMCTGVSDSDIIAL--VQKASHLRSISL------RVPSDF 313

  Fly   226 VLACPLLVMVEISI-----------CSLNRDEYRL----GELRYLQSLVIKAHSTDTIRCKVSDW 275
            .|  |||..:.:.:           || ..:.:::    ||...|.|..::...|...:|.|.: 
plant   314 TL--PLLNNITLRLTDESLSAIAQHCS-KLESFKISFSDGEFPSLFSFTLQGIITLIQKCPVRE- 374

  Fly   276 MLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPN-QPYRPNDLLRLRNLTFLET 339
              :||..|     .:|:|.        .:..:...::|.:|::.: |......|:.:.....|..
plant   375 --LSLDHV-----CVFNDM--------GMEALCSAQKLEILELVHCQEVSDEGLILVSQFPSLNV 424

  Fly   340 LDLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLLTNR 377
            |.||....:|::.:..|| |...|.:|:|:.||.::.|
plant   425 LKLSKCLGVTDDGMRPLV-GSHKLELLVVEDCPQVSRR 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 5/27 (19%)
leucine-rich repeat 157..179 CDD:275381 8/46 (17%)
leucine-rich repeat 180..204 CDD:275381 7/34 (21%)
leucine-rich repeat 205..231 CDD:275381 5/25 (20%)
leucine-rich repeat 232..285 CDD:275381 13/67 (19%)
leucine-rich repeat 286..326 CDD:275381 5/40 (13%)
AMN1 306..>376 CDD:187754 17/70 (24%)
leucine-rich repeat 337..362 CDD:275381 8/24 (33%)
AT1G80570NP_974191.1 AMN1 77..309 CDD:187754 48/254 (19%)
leucine-rich repeat 79..111 CDD:275381 6/21 (29%)
leucine-rich repeat 112..136 CDD:275381 4/30 (13%)
leucine-rich repeat 137..162 CDD:275381 4/32 (13%)
leucine-rich repeat 163..188 CDD:275381 7/31 (23%)
leucine-rich repeat 189..226 CDD:275381 8/36 (22%)
AMN1 241..435 CDD:187754 40/221 (18%)
leucine-rich repeat 250..275 CDD:275381 5/25 (20%)
leucine-rich repeat 276..301 CDD:275381 4/26 (15%)
leucine-rich repeat 302..339 CDD:275381 10/45 (22%)
leucine-rich repeat 340..368 CDD:275381 5/27 (19%)
leucine-rich repeat 372..396 CDD:275381 6/39 (15%)
leucine-rich repeat 397..421 CDD:275381 4/23 (17%)
leucine-rich repeat 422..446 CDD:275381 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.