DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and AT1G55590

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_175955.1 Gene:AT1G55590 / 842008 AraportID:AT1G55590 Length:607 Species:Arabidopsis thaliana


Alignment Length:424 Identity:83/424 - (19%)
Similarity:154/424 - (36%) Gaps:114/424 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LKQLDLKSRISFAASCDMFEN--IYVRSSPLRLSRVV---NLEEMIEFSLLET----KLFVELSG 75
            |:..||.|...|.::.....|  .|:.|..|.:..::   ...:.:.|||.||    :|...|..
plant   123 LEMADLDSPDVFQSNLTQMLNGCPYLESLQLNIRGILVDATAFQSVRFSLPETLKALRLQPLLES 187

  Fly    76 SDIEIIRGGPHTPMFSHFEDF------------IRLMSIRLTKVNE---IALEGF--QLTQYKWF 123
            ..|.::.....|..:....|:            ::.:|:.|..:::   ||:.|.  ||.:....
plant   188 EAILLMNRFKVTGTYLSQPDYNSALLSPSPSFTLQSLSLVLDLISDRLIIAITGSLPQLVKLDLE 252

  Fly   124 NAPETS---FSNLTYVSLRR---CQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLPTSLLS 182
            :.||..   .::|||..|:.   ||.          ||.|..:...||.:::...:..:...|||
plant   253 DRPEKEPFPDNDLTYTGLQALGFCQQ----------LTSLSLVRTCYNRKISFKRINDMGIFLLS 307

  Fly   183 LYITGCRNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIYRDL---------VLACPLLVMVEIS 238
               ..|:.|   :.:.|...|::.:...:.|:     |..|:|         :|:......|..|
plant   308 ---EACKGL---ESVRLGGFPKVSDAGFASLL-----HSCRNLKKFEVRGAFLLSDLAFHDVTGS 361

  Fly   239 ICSLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANA 303
            .|||  .|.||.....:.|..:|         |:.....:.:||:...::          :|.:.
plant   362 SCSL--QEVRLSTCPLITSEAVK---------KLGLCGNLEVLDLGSCKS----------ISDSC 405

  Fly   304 LSIISRFRQLRVLKMPNQPYRPNDLLRL--------------------RNLTF-----------L 337
            |:.:|..|:|..|.:.......:.:|.|                    |.:::           |
plant   406 LNSVSALRKLTSLNLAGADVTDSGMLALGKSDVPITQLSLRGCRRVSDRGISYLLNNEGTISKTL 470

  Fly   338 ETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGC 371
            .||||.:.|.|::..:..:......|:.|.::.|
plant   471 STLDLGHMPGISDRAIHTITHCCKALTELSIRSC 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 7/25 (28%)
leucine-rich repeat 157..179 CDD:275381 3/21 (14%)
leucine-rich repeat 180..204 CDD:275381 6/23 (26%)
leucine-rich repeat 205..231 CDD:275381 5/34 (15%)
leucine-rich repeat 232..285 CDD:275381 13/52 (25%)
leucine-rich repeat 286..326 CDD:275381 6/39 (15%)
AMN1 306..>376 CDD:187754 17/97 (18%)
leucine-rich repeat 337..362 CDD:275381 7/24 (29%)
AT1G55590NP_175955.1 leucine-rich repeat 14..43 CDD:275381
leucine-rich repeat 44..68 CDD:275381
leucine-rich repeat 69..85 CDD:275381
leucine-rich repeat 92..117 CDD:275381
leucine-rich repeat 118..147 CDD:275381 6/23 (26%)
leucine-rich repeat 148..174 CDD:275381 5/25 (20%)
leucine-rich repeat 176..218 CDD:275381 5/41 (12%)
leucine-rich repeat 221..245 CDD:275381 5/23 (22%)
leucine-rich repeat 246..274 CDD:275381 7/27 (26%)
leucine-rich repeat 279..300 CDD:275381 5/20 (25%)
leucine-rich repeat 313..338 CDD:275381 5/32 (16%)
leucine-rich repeat 339..364 CDD:275381 4/24 (17%)
leucine-rich repeat 365..389 CDD:275381 7/34 (21%)
AMN1 386..559 CDD:187754 21/129 (16%)
leucine-rich repeat 390..414 CDD:275381 5/33 (15%)
leucine-rich repeat 415..439 CDD:275381 4/23 (17%)
leucine-rich repeat 440..469 CDD:275381 1/28 (4%)
leucine-rich repeat 470..495 CDD:275381 7/24 (29%)
leucine-rich repeat 496..515 CDD:275381 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.