DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and AT1G15740

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_563980.2 Gene:AT1G15740 / 838143 AraportID:AT1G15740 Length:585 Species:Arabidopsis thaliana


Alignment Length:409 Identity:88/409 - (21%)
Similarity:161/409 - (39%) Gaps:81/409 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SRISFAASCDMFENIYVRSSPLR-LSRVVNLEEM-------IEFSLLETKLFVELSGSDIE---I 80
            |.:|...|.....|..:.:..:| ||.:|||:::       |:..|:..:...:|...:|:   .
plant   184 SGLSNLTSLSFRRNAAITAQGMRALSNLVNLKKLDLEKCPGIDGGLVHLRALTKLESLNIKWCNC 248

  Fly    81 IRGGPHTPMFSHFEDFIRLMSIR----------------LTKVNEIALEGFQLTQYKWFNAPETS 129
            |......|:    .....|.|::                |.|:|.:.|||.:.......:. .|:
plant   249 ITDADMEPL----SVLTNLRSLQICCSKITDIGISYLKGLNKLNLLNLEGCRHVTAACLDT-LTA 308

  Fly   130 FSNLTYVSLRRCQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLP--TSLLSLYITGCRNLC 192
            .:.|.|::|.||..:|.....:..|.:|:.|:|..|: :|.|||:.|.  |.|.||.:..|| :.
plant   309 LAGLMYLNLNRCNFSDSGCEKFSDLINLKILNLGMNN-ITNSCLVHLKGLTKLESLNLDSCR-IG 371

  Fly   193 PNQLIFLNRIPRLRELRASDLMPG--GHWHIYRDLVLACPLLVMVEISICSLNRDEYR-LGELRY 254
            ...|:.|:.:..|:.|..||...|  |..|:     .....|..:.:|...:.....| |..|..
plant   372 DEGLVHLSGMLELKSLELSDTEVGSNGLRHL-----SGLSNLESINLSFTVVTDSGLRKLSGLTS 431

  Fly   255 LQSLVIKA-HSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKM 318
            |::|.:.| |.||.           .|..:..|..|...|.....::.:..:.:...::|:.|::
plant   432 LRTLNLDARHVTDA-----------GLSALTSLTGLTHLDLFGARITDSGTNHLRNLKKLQSLEI 485

  Fly   319 PNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIELVIG------------------------ 359
            .........:..:::|:.|..|:||.:..:|:: .:||:.|                        
plant   486 CGGGLTDTGVKNIKDLSSLTLLNLSQNSNLTDK-TLELISGLTGLVSLNVSNSRVSSSGLRHLKP 549

  Fly   360 IPNLSVLIVQGCPLLTNRV 378
            :.||..|.::.|.|..|.:
plant   550 LKNLRSLTLESCKLSANDI 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 7/22 (32%)
leucine-rich repeat 157..179 CDD:275381 9/23 (39%)
leucine-rich repeat 180..204 CDD:275381 7/23 (30%)
leucine-rich repeat 205..231 CDD:275381 7/27 (26%)
leucine-rich repeat 232..285 CDD:275381 12/54 (22%)
leucine-rich repeat 286..326 CDD:275381 5/39 (13%)
AMN1 306..>376 CDD:187754 16/93 (17%)
leucine-rich repeat 337..362 CDD:275381 8/48 (17%)
AT1G15740NP_563980.2 leucine-rich repeat 62..98 CDD:275381
AMN1 86..275 CDD:187754 18/94 (19%)
leucine-rich repeat 114..139 CDD:275381
leucine-rich repeat 164..188 CDD:275381 1/3 (33%)
leucine-rich repeat 189..213 CDD:275381 5/23 (22%)
leucine-rich repeat 214..237 CDD:275381 3/22 (14%)
leucine-rich repeat 238..262 CDD:275381 4/27 (15%)
leucine-rich repeat 263..297 CDD:275381 8/33 (24%)
LRR_RI <298..470 CDD:238064 47/190 (25%)
leucine-rich repeat 298..335 CDD:275381 8/37 (22%)
LRR_8 311..370 CDD:290566 22/60 (37%)
leucine-rich repeat 336..359 CDD:275381 9/23 (39%)
leucine-rich repeat 384..402 CDD:275380 6/17 (35%)
leucine-rich repeat 408..431 CDD:275381 5/22 (23%)
leucine-rich repeat 432..455 CDD:275381 8/33 (24%)
leucine-rich repeat 456..479 CDD:275381 2/22 (9%)
leucine-rich repeat 480..523 CDD:275381 9/43 (21%)
leucine-rich repeat 529..552 CDD:275380 0/22 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.