| Sequence 1: | NP_573291.1 | Gene: | CG15056 / 32824 | FlyBaseID: | FBgn0030918 | Length: | 399 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_569047.1 | Gene: | SKIP2 / 836860 | AraportID: | AT5G67250 | Length: | 527 | Species: | Arabidopsis thaliana |
| Alignment Length: | 399 | Identity: | 71/399 - (17%) |
|---|---|---|---|
| Similarity: | 115/399 - (28%) | Gaps: | 168/399 - (42%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 87 TPMFSHFEDFIRL------------------MSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNL 133
Fly 134 TYVSLRRCQLNDENLVGWEFLTHLETLDLRYNDRLTG----SCLMSLPTSLLSLYITGCRNLCPN 194
Fly 195 QLIFLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYLQSLV 259
Fly 260 IKAHSTDTIRCKVSDWMLI--------SLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVL 316
Fly 317 KMPN---------------------QPYRPNDL------------LRLRNLTF------------ 336
Fly 337 -------LETLDLSNSPYITNEVV------------------------IE-LVIGIPNLSVLIVQ 369
Fly 370 GCPLLTNRV 378 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15056 | NP_573291.1 | leucine-rich repeat | 133..156 | CDD:275381 | 4/22 (18%) |
| leucine-rich repeat | 157..179 | CDD:275381 | 7/25 (28%) | ||
| leucine-rich repeat | 180..204 | CDD:275381 | 4/23 (17%) | ||
| leucine-rich repeat | 205..231 | CDD:275381 | 1/25 (4%) | ||
| leucine-rich repeat | 232..285 | CDD:275381 | 12/60 (20%) | ||
| leucine-rich repeat | 286..326 | CDD:275381 | 11/60 (18%) | ||
| AMN1 | 306..>376 | CDD:187754 | 25/146 (17%) | ||
| leucine-rich repeat | 337..362 | CDD:275381 | 10/49 (20%) | ||
| SKIP2 | NP_569047.1 | F-box-like | 45..>73 | CDD:403981 | |
| AMN1 | 82..295 | CDD:187754 | 47/258 (18%) | ||
| leucine-rich repeat | 106..128 | CDD:275381 | 1/21 (5%) | ||
| leucine-rich repeat | 135..160 | CDD:275381 | 2/24 (8%) | ||
| leucine-rich repeat | 161..185 | CDD:275381 | 5/25 (20%) | ||
| leucine-rich repeat | 239..264 | CDD:275381 | 8/32 (25%) | ||
| leucine-rich repeat | 265..288 | CDD:275381 | 7/27 (26%) | ||
| leucine-rich repeat | 289..314 | CDD:275381 | 3/24 (13%) | ||
| AMN1 | <311..>416 | CDD:187754 | 14/104 (13%) | ||
| leucine-rich repeat | 315..342 | CDD:275381 | 2/26 (8%) | ||
| leucine-rich repeat | 343..367 | CDD:275381 | 2/23 (9%) | ||
| leucine-rich repeat | 368..393 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 394..418 | CDD:275381 | 4/23 (17%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||