DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and AT5G27920

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_568502.1 Gene:AT5G27920 / 832858 AraportID:AT5G27920 Length:642 Species:Arabidopsis thaliana


Alignment Length:375 Identity:81/375 - (21%)
Similarity:138/375 - (36%) Gaps:108/375 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRCQLNDENLV--------- 149
            :||:|:.|:..|.:..:.:|......:|        :.||:.:.|..|...|:::|         
plant    36 KDFLRVDSLTRTTIRILRVEFLPTLLFK--------YPNLSSLDLSVCPKLDDDVVLRLALDGAI 92

  Fly   150 -------------------GWEFLTH----LETLDLR----YNDR-------LTG-------SCL 173
                               |.|.|..    ||.:|:.    :.||       .||       .||
plant    93 STLGIKSLNLSRSTAVRARGLETLARMCHALERVDVSHCWGFGDREAAALSSATGLRELKMDKCL 157

  Fly   174 MSLPTSLLSLYITGCRNLCPNQLIFLNRIPRL---------RELRASDLMPGGHWHIYRDLVLAC 229
             ||....|:..:.||.||....|.:...|..|         :.|::.|:   .:..|..|.:.:.
plant   158 -SLSDVGLARIVVGCSNLNKISLKWCMEISDLGIDLLCKICKGLKSLDV---SYLKITNDSIRSI 218

  Fly   230 PLLVMVEI---SICSLNRDEYRLGELRYLQSLVIKAHSTDTIRC-KVSDWMLISLL-DVPFLRNL 289
            .|||.:|:   ..|.|..|    |.|::|::........|..|| :||...|||:: ..|.::.|
plant   219 ALLVKLEVLDMVSCPLIDD----GGLQFLENGSPSLQEVDVTRCDRVSLSGLISIVRGHPDIQLL 279

  Fly   290 MFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRL----------------------- 331
            ..|...|. ||.:.|..|...:.|:.:.:.......:.|:.|                       
plant   280 KASHCVSE-VSGSFLKYIKGLKHLKTIWIDGAHVSDSSLVSLSSSCRSLMEIGLSRCVDVTDIGM 343

  Fly   332 ----RNLTFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLLTNR 377
                ||...|:||:|:...::|:..:..:.....||..|.::.|.|:|.:
plant   344 ISLARNCLNLKTLNLACCGFVTDVAISAVAQSCRNLGTLKLESCHLITEK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/50 (16%)
leucine-rich repeat 157..179 CDD:275381 11/39 (28%)
leucine-rich repeat 180..204 CDD:275381 7/23 (30%)
leucine-rich repeat 205..231 CDD:275381 5/34 (15%)
leucine-rich repeat 232..285 CDD:275381 17/57 (30%)
leucine-rich repeat 286..326 CDD:275381 8/39 (21%)
AMN1 306..>376 CDD:187754 16/96 (17%)
leucine-rich repeat 337..362 CDD:275381 5/24 (21%)
AT5G27920NP_568502.1 AMN1 65..261 CDD:187754 45/203 (22%)
leucine-rich repeat 67..96 CDD:275381 5/28 (18%)
leucine-rich repeat 97..122 CDD:275381 3/24 (13%)
leucine-rich repeat 123..147 CDD:275381 5/23 (22%)
leucine-rich repeat 148..173 CDD:275381 7/25 (28%)
leucine-rich repeat 174..199 CDD:275381 4/24 (17%)
AMN1 192..393 CDD:187754 46/208 (22%)
leucine-rich repeat 200..222 CDD:275381 5/24 (21%)
leucine-rich repeat 224..249 CDD:275381 7/28 (25%)
leucine-rich repeat 250..298 CDD:275381 16/48 (33%)
leucine-rich repeat 299..352 CDD:275381 5/52 (10%)
AMN1 <329..464 CDD:187754 13/65 (20%)
leucine-rich repeat 353..378 CDD:275381 5/24 (21%)
leucine-rich repeat 379..404 CDD:275381 5/15 (33%)
AMN1 405..>567 CDD:187754
leucine-rich repeat 405..429 CDD:275381
leucine-rich repeat 430..455 CDD:275381
leucine-rich repeat 456..481 CDD:275381
leucine-rich repeat 482..506 CDD:275381
leucine-rich repeat 507..532 CDD:275381
leucine-rich repeat 533..558 CDD:275381
leucine-rich repeat 559..583 CDD:275381
leucine-rich repeat 584..609 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.