DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and EBF2

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_197917.1 Gene:EBF2 / 832607 AraportID:AT5G25350 Length:623 Species:Arabidopsis thaliana


Alignment Length:428 Identity:87/428 - (20%)
Similarity:140/428 - (32%) Gaps:165/428 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SFAASCDMFENIYVRSSPLRLSRVVNLEEMIEFSLLE-----TKL---FVELSGSDIEIIRGGPH 86
            :.|..|....:|.:||.| |:.     ::.:.|.|.:     ||:   .:.:||..:.:|     
plant   239 AIARRCVNLRSISIRSCP-RIG-----DQGVAFLLAQAGSYLTKVKLQMLNVSGLSLAVI----- 292

  Fly    87 TPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWF---------------------------- 123
                .|:.          ..|.::.|.|.|....|.|                            
plant   293 ----GHYG----------AAVTDLVLHGLQGVNEKGFWVMGNAKGLKKLKSLSVMSCRGMTDVGL 343

  Fly   124 NAPETSFSNLTYVSLRRCQL-NDENLVGW-EFLTHLETLDLRYNDRLT----------------- 169
            .|......:|.:|||.:|.| :.:.||.. :....||:|.|....|:.                 
plant   344 EAVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGLMGFLMNCGSKLKA 408

  Fly   170 ---GSCL--------MSLP----TSLLSLYITGCRNLCPNQLIFLNRIPRLRELRASDLMPGGHW 219
               .:||        .|||    :||.||.|..|.......|.||                |...
plant   409 FSLANCLGISDFNSESSLPSPSCSSLRSLSIRCCPGFGDASLAFL----------------GKFC 457

  Fly   220 HIYRDLVLACPLLVMVEISICSLN--RDEYRLGELRYLQSL---VIKAHSTDTIRCKVSDWMLIS 279
            |..:|            :.:|.||  .|   .|....|||.   ::|.:.::.|  .||| ..:|
plant   458 HQLQD------------VELCGLNGVTD---AGVRELLQSNNVGLVKVNLSECI--NVSD-NTVS 504

  Fly   280 LLDVPFLRNL--MFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRLRNLTFLETLDL 342
            .:.|...|.|  :..|......:|:.:::....            |..||            ||:
plant   505 AISVCHGRTLESLNLDGCKNITNASLVAVAKNC------------YSVND------------LDI 545

  Fly   343 SNSPYITNEVVIELVIGIP---NLSVLIVQGCPLLTNR 377
            ||:  :.::..|:.:...|   ||.||.:.||..:|::
plant   546 SNT--LVSDHGIKALASSPNHLNLQVLSIGGCSSITDK 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/24 (33%)
leucine-rich repeat 157..179 CDD:275381 10/53 (19%)
leucine-rich repeat 180..204 CDD:275381 8/23 (35%)
leucine-rich repeat 205..231 CDD:275381 3/25 (12%)
leucine-rich repeat 232..285 CDD:275381 15/57 (26%)
leucine-rich repeat 286..326 CDD:275381 5/41 (12%)
AMN1 306..>376 CDD:187754 15/72 (21%)
leucine-rich repeat 337..362 CDD:275381 6/27 (22%)
EBF2NP_197917.1 F-box 54..>92 CDD:279040
AMN1 <138..268 CDD:187754 8/34 (24%)
leucine-rich repeat 169..194 CDD:275381
leucine-rich repeat 195..220 CDD:275381
leucine-rich repeat 221..246 CDD:275381 2/6 (33%)
leucine-rich repeat 247..278 CDD:275381 9/36 (25%)
leucine-rich repeat 279..326 CDD:275381 10/65 (15%)
leucine-rich repeat 327..352 CDD:275381 1/24 (4%)
leucine-rich repeat 353..378 CDD:275381 8/24 (33%)
leucine-rich repeat 379..402 CDD:275381 5/22 (23%)
leucine-rich repeat 406..459 CDD:275381 15/68 (22%)
leucine-rich repeat 407..433 CDD:275381 5/25 (20%)
AMN1 435..>582 CDD:187754 45/207 (22%)
leucine-rich repeat 460..511 CDD:275381 16/68 (24%)
leucine-rich repeat 487..512 CDD:275381 7/27 (26%)
leucine-rich repeat 514..537 CDD:275381 3/22 (14%)
leucine-rich repeat 540..566 CDD:275381 8/39 (21%)
leucine-rich repeat 567..595 CDD:275381 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.