DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and AT5G01720

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_568094.2 Gene:AT5G01720 / 831688 AraportID:AT5G01720 Length:665 Species:Arabidopsis thaliana


Alignment Length:409 Identity:84/409 - (20%)
Similarity:147/409 - (35%) Gaps:124/409 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVNLEEMIEFSLLETKLFVELSGSDIEIIRGG 84
            ||:||       |:||   :|:..|.....||....|:.:                 |:      
plant   254 LKKLD-------ASSC---QNLTHRGLTSLLSGAGYLQRL-----------------DL------ 285

  Fly    85 PHTPMFSHFEDFIRL-MSIRLTKVN---EIALEGFQLTQYKWFNAPETSFSNLTYVSLRRC-QLN 144
                  ||....|.| .:..|.||:   .|.|:|..:|. ....|..|..::|..|||.:| .:.
plant   286 ------SHCSSVISLDFASSLKKVSALQSIRLDGCSVTP-DGLKAIGTLCNSLKEVSLSKCVSVT 343

  Fly   145 DENLVGWEFLTHLETLDLRYNDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLNRIPRLRELR 209
            ||.|                     .|.:|.| ..|..|.||.||.|.                |
plant   344 DEGL---------------------SSLVMKL-KDLRKLDITCCRKLS----------------R 370

  Fly   210 ASDLMPGGHWHIYRDLVLACPLLVMVEISICSL-NRDEYRL--GELRYLQSLVIKAHSTDTIRCK 271
            .|          ...:..:|||||.:::..||| :|:.:.|  .:.|.|:.|.:..:..|....|
plant   371 VS----------ITQIANSCPLLVSLKMESCSLVSREAFWLIGQKCRLLEELDLTDNEIDDEGLK 425

  Fly   272 -VSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSI--ISRFRQLRV--------------LKMP 319
             :|..:.:|.|.:....|:  :|....::.....::  :..:|.:.:              |:..
plant   426 SISSCLSLSSLKLGICLNI--TDKGLSYIGMGCSNLRELDLYRSVGITDVGISTIAQGCIHLETI 488

  Fly   320 N----QPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLLTNRVYL 380
            |    |......|:.|...:.|:|.:....|.||::.:..:.:....|:.:.::.||.:.     
plant   489 NISYCQDITDKSLVSLSKCSLLQTFESRGCPNITSQGLAAIAVRCKRLAKVDLKKCPSIN----- 548

  Fly   381 DAELASKKRSNGNMVKVQL 399
            ||.|.:....:.|:.::.:
plant   549 DAGLLALAHFSQNLKQINV 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/23 (35%)
leucine-rich repeat 157..179 CDD:275381 3/21 (14%)
leucine-rich repeat 180..204 CDD:275381 7/23 (30%)
leucine-rich repeat 205..231 CDD:275381 3/25 (12%)
leucine-rich repeat 232..285 CDD:275381 15/56 (27%)
leucine-rich repeat 286..326 CDD:275381 6/59 (10%)
AMN1 306..>376 CDD:187754 14/89 (16%)
leucine-rich repeat 337..362 CDD:275381 5/24 (21%)
AT5G01720NP_568094.2 AMN1 60..>201 CDD:187754
leucine-rich repeat 74..93 CDD:275381
leucine-rich repeat 101..126 CDD:275381
leucine-rich repeat 127..151 CDD:275381
leucine-rich repeat 152..172 CDD:275381
leucine-rich repeat 178..203 CDD:275381
AMN1 196..372 CDD:187754 45/195 (23%)
leucine-rich repeat 204..247 CDD:275381
leucine-rich repeat 254..279 CDD:275381 11/34 (32%)
leucine-rich repeat 280..330 CDD:275381 15/79 (19%)
AMN1 <328..500 CDD:187754 44/221 (20%)
leucine-rich repeat 331..356 CDD:275381 11/46 (24%)
leucine-rich repeat 357..382 CDD:275381 10/50 (20%)
leucine-rich repeat 383..408 CDD:275381 7/24 (29%)
leucine-rich repeat 409..458 CDD:275381 9/50 (18%)
AMN1 <441..567 CDD:187754 20/132 (15%)
leucine-rich repeat 459..484 CDD:275381 1/24 (4%)
leucine-rich repeat 485..507 CDD:275381 5/21 (24%)
leucine-rich repeat 510..535 CDD:275381 5/24 (21%)
leucine-rich repeat 536..561 CDD:275381 6/29 (21%)
leucine-rich repeat 562..585 CDD:275381 0/6 (0%)
leucine-rich repeat 586..609 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.