DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and SLOMO

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_567916.2 Gene:SLOMO / 829457 AraportID:AT4G33210 Length:990 Species:Arabidopsis thaliana


Alignment Length:365 Identity:83/365 - (22%)
Similarity:122/365 - (33%) Gaps:123/365 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RLMSIRLT---KVNEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRCQL-NDENLVGWEFLTH-L 157
            ||.||.|.   |..::.|:...|:.....|.|......:|..:|||..| ..|||.......| |
plant   489 RLQSISLVHCRKFTDLNLQSIMLSSITVSNCPALRRITITSNALRRLALQKQENLTTLVLQCHSL 553

  Fly   158 ETLDLRYNDRLT----------GSC--LMSL--------------PTSLLSLYITGCRNL----- 191
            :.:||...:.|:          |.|  |.||              .:||.||.:.|||.:     
plant   554 QEVDLSDCESLSNSVCKIFSDDGGCPMLKSLILDNCESLTAVRFCNSSLASLSLVGCRAVTSLEL 618

  Fly   192 -CPN-----------------QLIFLNRI-----PRLRELR-------ASDLMPGGHWHIYRDLV 226
             ||.                 |.:.|..:     |:|..|.       :.:|...|   :..:..
plant   619 KCPRIEQICLDGCDHLETAFFQPVALRSLNLGICPKLSVLNIEAPYMVSLELKGCG---VLSEAS 680

  Fly   227 LACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMF 291
            :.||||..::.|.||..||:               ..|..|..|             |.:.:|:.
plant   681 IMCPLLTSLDASFCSQLRDD---------------CLSATTASC-------------PLIESLVL 717

  Fly   292 SDAPS----GFVSANAL-----------------SIISRFRQLRVLKMPNQPYRPND----LLRL 331
            ...||    |..|.|.|                 .:.....||:|||:....|..:.    |.:.
plant   718 MSCPSIGSDGLSSLNGLPNLTVLDLSYTFLMNLEPVFKSCIQLKVLKLQACKYLTDSSLEPLYKE 782

  Fly   332 RNLTFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGC 371
            ..|..||.||||... :....:.:|:....:|:.|.:.||
plant   783 GALPALEELDLSYGT-LCQTAIDDLLACCTHLTHLSLNGC 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/23 (35%)
leucine-rich repeat 157..179 CDD:275381 9/47 (19%)
leucine-rich repeat 180..204 CDD:275381 10/51 (20%)
leucine-rich repeat 205..231 CDD:275381 5/32 (16%)
leucine-rich repeat 232..285 CDD:275381 9/52 (17%)
leucine-rich repeat 286..326 CDD:275381 13/60 (22%)
AMN1 306..>376 CDD:187754 19/70 (27%)
leucine-rich repeat 337..362 CDD:275381 7/24 (29%)
SLOMONP_567916.2 F-box-like 195..234 CDD:372399
leucine-rich repeat 208..257 CDD:275381
leucine-rich repeat 258..282 CDD:275381
leucine-rich repeat 283..306 CDD:275381
leucine-rich repeat 307..326 CDD:275381
leucine-rich repeat 331..350 CDD:275381
AMN1 344..523 CDD:187754 10/33 (30%)
leucine-rich repeat 371..396 CDD:275381
leucine-rich repeat 397..422 CDD:275381
leucine-rich repeat 423..443 CDD:275381
leucine-rich repeat 444..468 CDD:275381
leucine-rich repeat 469..489 CDD:275381 83/365 (23%)
leucine-rich repeat 490..521 CDD:275381 8/30 (27%)
AMN1 <516..660 CDD:187754 34/143 (24%)
leucine-rich repeat 522..552 CDD:275381 8/29 (28%)
leucine-rich repeat 602..622 CDD:275381 7/19 (37%)
leucine-rich repeat 623..643 CDD:275381 1/19 (5%)
leucine-rich repeat 644..664 CDD:275381 4/19 (21%)
AMN1 682..>826 CDD:187754 39/169 (23%)
leucine-rich repeat 686..711 CDD:275381 9/52 (17%)
leucine-rich repeat 712..731 CDD:275381 4/18 (22%)
leucine-rich repeat 737..759 CDD:275381 0/21 (0%)
leucine-rich repeat 760..787 CDD:275381 7/26 (27%)
leucine-rich repeat 788..812 CDD:275381 7/24 (29%)
leucine-rich repeat 906..951 CDD:275381
leucine-rich repeat 952..977 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.