DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and GRH1

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_567255.1 Gene:GRH1 / 828045 AraportID:AT4G03190 Length:585 Species:Arabidopsis thaliana


Alignment Length:441 Identity:89/441 - (20%)
Similarity:148/441 - (33%) Gaps:179/441 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LKQLDLKSRISFA-----------ASCDMFENIYVRSSPL---RLSRVVNLEEMIEFSLLETKLF 70
            ::.|.||.:..||           .:....|.:..:||.|   |:.|:|..:|.:|         
plant    64 MRSLTLKGKPHFADYNLVPDGWGGYAWPWIEAMAAKSSSLEEIRMKRMVVTDECLE--------- 119

  Fly    71 VELSGSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTY 135
             :::.|                |:||..|:   ||.....:.:|..        |...:..||..
plant   120 -KIAAS----------------FKDFKVLV---LTSCEGFSTDGIA--------AIAATCRNLRV 156

  Fly   136 VSLRRCQLNDENLVGWEFL-------THLETLDLRYNDRLTGSC------------LMSLPTSLL 181
            :.||.|.:.|   :|.::|       |.|.:||.        ||            |:|...:|.
plant   157 LELRECIVED---LGGDWLSYFPESSTSLVSLDF--------SCLDSEVKISDLERLVSRSPNLK 210

  Fly   182 SLYITGCRNLCPNQLIFLNR-IPRLRELR----ASDLMP-------------------GGHWHIY 222
            ||.:.....|  :.|:.|.| .|:|.||.    |:.|.|                   .|.|.:.
plant   211 SLKLNPAVTL--DGLVSLLRCAPQLTELGTGSFAAQLKPEAFSKLSEAFSNCKQLQSLSGLWDVL 273

  Fly   223 RD----LVLACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAHSTDTIRC-KVSDWMLISLLD 282
            .:    |...||.|..:.:|..::     |:.:|..|..           || |:....::.|::
plant   274 PEYLPALYSVCPGLTSLNLSYATV-----RMPDLVELLR-----------RCSKLQKLWVMDLIE 322

  Fly   283 VPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPY 347
            ...|..:              .|.....|:|||  .|::|                .||.:|.| 
plant   323 DKGLEAV--------------ASYCKELRELRV--FPSEP----------------DLDATNIP- 354

  Fly   348 ITNEVVIELVIGIPNLSVLIVQGCPLLTNRVYLDAELA-------SKKRSN 391
            :|.:       |:    |.:.:||..|.:.:|...:..       ::||.|
plant   355 LTEQ-------GL----VFVSKGCRKLESVLYFCVQFTNAALFTIARKRPN 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 7/29 (24%)
leucine-rich repeat 157..179 CDD:275381 7/33 (21%)
leucine-rich repeat 180..204 CDD:275381 7/24 (29%)
leucine-rich repeat 205..231 CDD:275381 10/52 (19%)
leucine-rich repeat 232..285 CDD:275381 9/53 (17%)
leucine-rich repeat 286..326 CDD:275381 8/39 (21%)
AMN1 306..>376 CDD:187754 16/69 (23%)
leucine-rich repeat 337..362 CDD:275381 6/24 (25%)
GRH1NP_567255.1 F-box_5 4..43 CDD:408301
Transp_inhibit 62..108 CDD:408562 9/43 (21%)
leucine-rich repeat 103..127 CDD:275381 8/49 (16%)
AMN1 <112..267 CDD:187754 42/204 (21%)
leucine-rich repeat 128..153 CDD:275381 6/35 (17%)
leucine-rich repeat 154..208 CDD:275381 15/64 (23%)
leucine-rich repeat 209..232 CDD:275381 7/24 (29%)
leucine-rich repeat 233..279 CDD:275381 8/45 (18%)
AMN1 280..488 CDD:187754 34/175 (19%)
leucine-rich repeat 287..311 CDD:275381 7/39 (18%)
leucine-rich repeat 312..335 CDD:275381 3/36 (8%)
leucine-rich repeat 336..369 CDD:275381 15/62 (24%)
leucine-rich repeat 370..394 CDD:275381 4/23 (17%)
leucine-rich repeat 395..429 CDD:275381 89/441 (20%)
leucine-rich repeat 430..453 CDD:275381
leucine-rich repeat 454..478 CDD:275381
leucine-rich repeat 479..498 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.