DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and AT4G03630

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_192272.1 Gene:AT4G03630 / 825663 AraportID:AT4G03630 Length:220 Species:Arabidopsis thaliana


Alignment Length:191 Identity:38/191 - (19%)
Similarity:65/191 - (34%) Gaps:78/191 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ASCDMFENIYVRSSPLRLSRVVNLEEMIEFSLLETKLFVELSGSDIEIIRGGPHTPMFSHFEDFI 97
            |.||....:.:.:..::|..:.:||  :.:.|::        |.::|.|.              .
plant    70 AKCDQITGMGLFTEAMKLPLLEDLE--LSYCLIK--------GKNLEAIG--------------F 110

  Fly    98 RLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTY------VSLRRCQLNDENLVG------ 150
            ..:.::..|:|   .:||:             |...||      ::.|..:|....|.|      
plant   111 ACLHLKTLKLN---CQGFK-------------FPGFTYDHDALGIAKRMPELRCLQLFGNRVSDV 159

  Fly   151 -----WEFLTHLETLDLR--YNDRLTGS----CLMSL---------------PTSLLSLYI 185
                 ::...|||.||||  :|..|.|.    |:..:               .||||.|.|
plant   160 GLNAIFDGCPHLEHLDLRQCFNINLVGDLEKRCMERIKDLRRPNDSTADYPYDTSLLDLGI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 6/39 (15%)
leucine-rich repeat 157..179 CDD:275381 10/42 (24%)
leucine-rich repeat 180..204 CDD:275381 4/6 (67%)
leucine-rich repeat 205..231 CDD:275381
leucine-rich repeat 232..285 CDD:275381
leucine-rich repeat 286..326 CDD:275381
AMN1 306..>376 CDD:187754
leucine-rich repeat 337..362 CDD:275381
AT4G03630NP_192272.1 AMN1 <39..179 CDD:187754 28/148 (19%)
leucine-rich repeat 64..89 CDD:275381 4/18 (22%)
leucine-rich repeat 90..114 CDD:275381 6/47 (13%)
leucine-rich repeat 115..145 CDD:275381 8/45 (18%)
leucine-rich repeat 146..170 CDD:275381 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.