DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and TIR1

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_567135.1 Gene:TIR1 / 825473 AraportID:AT3G62980 Length:594 Species:Arabidopsis thaliana


Alignment Length:477 Identity:101/477 - (21%)
Similarity:167/477 - (35%) Gaps:175/477 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LKSRISFAASCDMFENIYVRSSPLRLSRVVNLEEMIEFSLLE------TKLFVE--LSGSDIEII 81
            ::.||:.:...::.|:::   |.::|.:..|...::..|..|      .|:|:.  .:.|...:|
plant     1 MQKRIALSFPEEVLEHVF---SFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVI 62

  Fly    82 RGGPHTPMFS-----HFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRC 141
            |..|......     ||.||            .:..:|:....|.|..|..:|::.|..:.|:|.
plant    63 RRFPKVRSVELKGKPHFADF------------NLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRM 115

  Fly   142 QLNDE--NLVGWEF-------------------------LTHLETLDLRYN--DRLTGSCLMSLP 177
            .:.|:  .|:...|                         ..:|:.||||.:  |.::|..|...|
plant   116 VVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFP 180

  Fly   178 ---TSLLSL----------------YITGCRNLCPNQL----------IFLNRIPRLRELRAS-- 211
               |||:||                .:|.|.||...:|          ..|.|.|:|.||...  
plant   181 DTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGY 245

  Fly   212 ------DLMPG---------------GHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYL 255
                  |:..|               |.|.       |.|..:....|:||      ||..|.. 
plant   246 TAEVRPDVYSGLSVALSGCKELRCLSGFWD-------AVPAYLPAVYSVCS------RLTTLNL- 296

  Fly   256 QSLVIKAHSTDTIRCKVSDWMLISLL-DVPFLRNLMFSDAPSGFVSANALSIISR----FRQLRV 315
                  :::|      |..:.|:.|| ..|.|:.|...|    ::....|.:::.    .|:|||
plant   297 ------SYAT------VQSYDLVKLLCQCPKLQRLWVLD----YIEDAGLEVLASTCKDLRELRV 345

  Fly   316 LKMPNQPY--RPNDLLRLRNLTFLETLDLSNSPYITNEVVIELVIGIPNL-SVLIVQGCPLLTNR 377
              .|::|:  .||..|                   |.:.::.:.:|.|.| |||..  |..:|| 
plant   346 --FPSEPFVMEPNVAL-------------------TEQGLVSVSMGCPKLESVLYF--CRQMTN- 386

  Fly   378 VYLDAELASKKRSNGNMVKVQL 399
                |.|.:..|:..||.:.:|
plant   387 ----AALITIARNRPNMTRFRL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 6/49 (12%)
leucine-rich repeat 157..179 CDD:275381 9/26 (35%)
leucine-rich repeat 180..204 CDD:275381 10/49 (20%)
leucine-rich repeat 205..231 CDD:275381 8/48 (17%)
leucine-rich repeat 232..285 CDD:275381 11/53 (21%)
leucine-rich repeat 286..326 CDD:275381 10/45 (22%)
AMN1 306..>376 CDD:187754 17/76 (22%)
leucine-rich repeat 337..362 CDD:275381 2/24 (8%)
TIR1NP_567135.1 F-box_5 8..47 CDD:408301 6/41 (15%)
Transp_inhibit 66..112 CDD:408562 11/57 (19%)
leucine-rich repeat 107..131 CDD:275381 6/23 (26%)
AMN1 <116..>224 CDD:187754 22/107 (21%)
leucine-rich repeat 132..157 CDD:275381 0/24 (0%)
leucine-rich repeat 158..212 CDD:275381 16/53 (30%)
leucine-rich repeat 213..286 CDD:275381 14/79 (18%)
AMN1 286..>400 CDD:187754 39/164 (24%)
leucine-rich repeat 291..315 CDD:275381 7/36 (19%)
leucine-rich repeat 316..339 CDD:275381 4/26 (15%)
leucine-rich repeat 340..373 CDD:275381 11/53 (21%)
leucine-rich repeat 374..398 CDD:275381 10/30 (33%)
leucine-rich repeat 399..433 CDD:275381 2/6 (33%)
leucine-rich repeat 434..457 CDD:275381
leucine-rich repeat 458..482 CDD:275381
leucine-rich repeat 483..507 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.