DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and RPP1

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001326420.1 Gene:RPP1 / 823573 AraportID:AT3G44480 Length:1240 Species:Arabidopsis thaliana


Alignment Length:334 Identity:71/334 - (21%)
Similarity:121/334 - (36%) Gaps:92/334 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSF----------SNLTYVSLRRCQLNDENLV 149
            :|:..:.:|.:.:.::.....||...||.:...:|:          :||..:.||.|....|...
plant   691 EFLVELDMRSSNLRKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELKLRNCSSLVELPS 755

  Fly   150 GWEFLTHLETLDLRYNDRL------------------TGSCLMSLP------TSLLSLYITGCRN 190
            ..|.||.|:.|||.....|                  ..|.|:.||      |:|..|.|:||.:
plant   756 SIEKLTSLQILDLENCSSLEKLPAIENATKLRELKLQNCSSLIELPLSIGTATNLKQLNISGCSS 820

  Fly   191 L--CPNQLIFLNRIPRLRELRASDL--------MP---GGHWHIYRDLVLACPLLVMVEISICSL 242
            |  .|:.      |..:.:|...||        :|   |...::.:.::..|..|..:.|:|...
plant   821 LVKLPSS------IGDITDLEVFDLSNCSSLVTLPSSIGNLQNLCKLIMRGCSKLEALPININLK 879

  Fly   243 NRDEYRLGELRYLQS----------LVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSG 297
            :.|...|.:...|:|          |.:|..:...:...:..|..::...:.:..:||  :.|..
plant   880 SLDTLNLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSIMSWSPLADFQISYFESLM--EFPHA 942

  Fly   298 FVSANALSI----------ISRFRQLRVLKMPNQPYRPNDLLRLRNLT------------FLETL 340
            |.....|.:          :.|..:||.|.:.|    .|:|:.|..|:            .||.|
plant   943 FDIITKLHLSKDIQEVPPWVKRMSRLRDLSLNN----CNNLVSLPQLSDSLDYIYADNCKSLERL 1003

  Fly   341 DLS-NSPYI 348
            |.. |:|.|
plant  1004 DCCFNNPEI 1012

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 7/22 (32%)
leucine-rich repeat 157..179 CDD:275381 9/45 (20%)
leucine-rich repeat 180..204 CDD:275381 8/25 (32%)
leucine-rich repeat 205..231 CDD:275381 6/36 (17%)
leucine-rich repeat 232..285 CDD:275381 10/62 (16%)
leucine-rich repeat 286..326 CDD:275381 10/49 (20%)
AMN1 306..>376 CDD:187754 16/66 (24%)
leucine-rich repeat 337..362 CDD:275381 7/13 (54%)
RPP1NP_001326420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.