DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and AFB2

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_566800.1 Gene:AFB2 / 822296 AraportID:AT3G26810 Length:575 Species:Arabidopsis thaliana


Alignment Length:483 Identity:103/483 - (21%)
Similarity:166/483 - (34%) Gaps:168/483 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFISFSVISR-FDFFWLDVLKQLDLKSRISFAASCDMFENIYVRSSPLRLSR---------VVN 55
            ||:....||.. |||.       ...|.|.:.:..|..:..|.      |.||         .:|
plant     1 MNYFPDEVIEHVFDFV-------TSHKDRNAISLVCKSWYKIE------RYSRQKVFIGNCYAIN 52

  Fly    56 LEEMI-EFSLLETKLFVELSGSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTKVNEIALE--GFQL 117
            .|.:: .|..|::.           .::|.|      ||.||           |.:..|  ||.|
plant    53 PERLLRRFPCLKSL-----------TLKGKP------HFADF-----------NLVPHEWGGFVL 89

  Fly   118 TQYKWFNAPETSFSNLTYVSLRRCQLNDEN---------------LVGWEFLT------------ 155
               .|..|...|...|..:.|:|..:.||:               ||..|..|            
plant    90 ---PWIEALARSRVGLEELRLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFTTDGLASIAANCR 151

  Fly   156 HLETLDLRYN--DRLTG---SCLMSLPTSLLSL---YITGCRNLCPNQLIFLNRIPRLRELRASD 212
            ||..|||:.|  |...|   ||.....|:|::|   .:.|..||...:.: :.|.|.|:.|:.:.
plant   152 HLRDLDLQENEIDDHRGQWLSCFPDTCTTLVTLNFACLEGETNLVALERL-VARSPNLKSLKLNR 215

  Fly   213 LMPGGHWHIYRDL---VLACPLLVMVEISICSLNRD----EY--------RLGELRYLQSLVIKA 262
            .:|       .|.   ::||...: |::.:.|...|    .|        :...||.|...:..|
plant   216 AVP-------LDALARLMACAPQI-VDLGVGSYENDPDSESYLKLMAVIKKCTSLRSLSGFLEAA 272

  Fly   263 -----------HSTDTIR----CKVSDWMLISLLD-VPFLRNLMFSDAPSGFVSANALSIIS--- 308
                       |:..::.    .::....||.|:. ...|:.|...|:    :....|.:::   
plant   273 PHCLSAFHPICHNLTSLNLSYAAEIHGSHLIKLIQHCKKLQRLWILDS----IGDKGLEVVASTC 333

  Fly   309 -RFRQLRVLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIELVIGIPNL-SVLIVQGC 371
             ..::|||.        |:|||...|..            :|.|.::.:..|.|.| |:|..  |
plant   334 KELQELRVF--------PSDLLGGGNTA------------VTEEGLVAISAGCPKLHSILYF--C 376

  Fly   372 PLLTNRVYLDAELASKKRSNGNMVKVQL 399
            ..:||     |.|.:..::..|.::.:|
plant   377 QQMTN-----AALVTVAKNCPNFIRFRL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 9/49 (18%)
leucine-rich repeat 157..179 CDD:275381 9/26 (35%)
leucine-rich repeat 180..204 CDD:275381 6/26 (23%)
leucine-rich repeat 205..231 CDD:275381 6/28 (21%)
leucine-rich repeat 232..285 CDD:275381 12/80 (15%)
leucine-rich repeat 286..326 CDD:275381 7/43 (16%)
AMN1 306..>376 CDD:187754 16/74 (22%)
leucine-rich repeat 337..362 CDD:275381 3/24 (13%)
AFB2NP_566800.1 F-box_5 1..42 CDD:408301 14/53 (26%)
Transp_inhibit 61..107 CDD:408562 16/76 (21%)
leucine-rich repeat 102..126 CDD:275381 5/23 (22%)
AMN1 <111..>219 CDD:187754 27/115 (23%)
leucine-rich repeat 127..152 CDD:275381 4/24 (17%)
leucine-rich repeat 153..207 CDD:275381 16/54 (30%)
leucine-rich repeat 208..261 CDD:275381 10/60 (17%)
leucine-rich repeat 286..311 CDD:275381 3/24 (13%)
AMN1 304..>393 CDD:187754 25/119 (21%)
leucine-rich repeat 312..335 CDD:275381 4/26 (15%)
leucine-rich repeat 336..368 CDD:275381 11/51 (22%)
leucine-rich repeat 369..393 CDD:275381 8/30 (27%)
leucine-rich repeat 394..428 CDD:275381 1/6 (17%)
leucine-rich repeat 429..452 CDD:275381
leucine-rich repeat 453..477 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.