DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and EBF1

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_565597.1 Gene:EBF1 / 817087 AraportID:AT2G25490 Length:628 Species:Arabidopsis thaliana


Alignment Length:412 Identity:80/412 - (19%)
Similarity:151/412 - (36%) Gaps:112/412 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LDVLKQLDLKSRISFAASCDMFENIYVRSSPL-RLSRVVNLEEMIEFSLLETKLFVELSGSDIEI 80
            |:...::..:..::.|.||...:::.:::.|| |...:.:|......||.:.||.: |:.:|:.:
plant   236 LEACSRIGDEGLLAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLKLQM-LNVTDVSL 299

  Fly    81 IRGGPHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRCQ--- 142
                   .:..|:.  :.:..:.|..::.::.:||      |..........|..:::..||   
plant   300 -------AVVGHYG--LSITDLVLAGLSHVSEKGF------WVMGNGVGLQKLNSLTITACQGVT 349

  Fly   143 ------------------------LNDENLVGW-EFLTHLETLDLRYNDRLT-----GSCLMSLP 177
                                    |:|..||.: :....||:|.|....|:|     || |::..
plant   350 DMGLESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGS-LLNCG 413

  Fly   178 TSLLSLYITGC---RNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIYRDLVLA-----CPLLVM 234
            ..|.:..:..|   |:|... |...:....||.|...: .||     :.|..||     ||.|  
plant   414 EKLKAFSLVNCLSIRDLTTG-LPASSHCSALRSLSIRN-CPG-----FGDANLAAIGKLCPQL-- 469

  Fly   235 VEISICSLNRDEYRLGELRYLQSLVIK------AHSTDTIRCKV---SDWMLISLLDVPFLRNLM 290
            .:|.:|.| :.....|.|..:||.::|      ::.||.:...:   :.|.| .:|::       
plant   470 EDIDLCGL-KGITESGFLHLIQSSLVKINFSGCSNLTDRVISAITARNGWTL-EVLNI------- 525

  Fly   291 FSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIE 355
              |..|....|:.:||.:                        |...|..||:|......:.:...
plant   526 --DGCSNITDASLVSIAA------------------------NCQILSDLDISKCAISDSGIQAL 564

  Fly   356 LVIGIPNLSVLIVQGCPLLTNR 377
            .......|.:|.|.||.::|::
plant   565 ASSDKLKLQILSVAGCSMVTDK 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 7/50 (14%)
leucine-rich repeat 157..179 CDD:275381 9/26 (35%)
leucine-rich repeat 180..204 CDD:275381 5/26 (19%)
leucine-rich repeat 205..231 CDD:275381 9/30 (30%)
leucine-rich repeat 232..285 CDD:275381 14/61 (23%)
leucine-rich repeat 286..326 CDD:275381 5/39 (13%)
AMN1 306..>376 CDD:187754 11/69 (16%)
leucine-rich repeat 337..362 CDD:275381 4/24 (17%)
EBF1NP_565597.1 F-box-like 64..101 CDD:372399
AMN1 <149..298 CDD:187754 14/62 (23%)
leucine-rich repeat 179..204 CDD:275381
leucine-rich repeat 205..230 CDD:275381
leucine-rich repeat 231..256 CDD:275381 4/19 (21%)
leucine-rich repeat 257..283 CDD:275381 4/25 (16%)
leucine-rich repeat 284..308 CDD:275381 6/33 (18%)
leucine-rich repeat 309..336 CDD:275381 4/32 (13%)
leucine-rich repeat 337..362 CDD:275381 3/24 (13%)
leucine-rich repeat 363..388 CDD:275381 4/24 (17%)
leucine-rich repeat 416..442 CDD:275381 5/26 (19%)
AMN1 440..611 CDD:187754 40/190 (21%)
leucine-rich repeat 443..468 CDD:275381 9/30 (30%)
leucine-rich repeat 469..492 CDD:275381 7/25 (28%)
leucine-rich repeat 493..519 CDD:275381 3/25 (12%)
leucine-rich repeat 520..545 CDD:275381 8/58 (14%)
leucine-rich repeat 546..571 CDD:275381 4/24 (17%)
leucine-rich repeat 572..591 CDD:275381 6/15 (40%)
leucine-rich repeat 598..619 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.