DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and AT2G17020

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_565400.1 Gene:AT2G17020 / 816205 AraportID:AT2G17020 Length:656 Species:Arabidopsis thaliana


Alignment Length:381 Identity:78/381 - (20%)
Similarity:130/381 - (34%) Gaps:151/381 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VRSSPLRLSRVVNLEEMIEFSLLETKLFVELSG--SDIEIIRGGP-HTPMFSHFED-FIRLMSIR 103
            :|.:||...|.|:  ::.:|.|.|    :..:|  ..:.:||... |...|....| .:..::.:
plant   266 IRDAPLEDPRQVS--DLTDFGLHE----INQNGKLKHLSLIRSQEFHPTYFRRVSDQGMLFLADK 324

  Fly   104 LTKVNEIALEGF----------------QLTQYKWFNAPE-----------TSFSNLTYVSLRRC 141
            ...:..|.|.||                .|:::..::.|:           |:.| |::||||||
plant   325 CLGMETICLGGFCRVTDAGFKTILHSCASLSKFSIYHGPKLTDLVFHDILATTLS-LSHVSLRRC 388

  Fly   142 QLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLPTSLL--SLYITGCRNLCPNQLIFLNRIPR 204
            .|                        ||...:..|.:||.  :|.:.|||||....|..::.:|:
plant   389 HL------------------------LTDHAIQKLASSLKLENLDLRGCRNLRDETLTAVSHLPK 429

  Fly   205 LRELRASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAHSTDTIR 269
            |:.|                      ||...:||...|:          ||:..|:.:       
plant   430 LKVL----------------------LLDGADISDTGLS----------YLKEGVLDS------- 455

  Fly   270 CKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRLRNL 334
                   |:| |.|...|||......:.|..::.|:                             
plant   456 -------LVS-LSVRGCRNLTDKFMSTLFDGSSKLA----------------------------- 483

  Fly   335 TFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLL---------TNRVYLD 381
              |..|||||.|.:|:..:..|......::.|.::.|.|:         :.|||.|
plant   484 --LRELDLSNLPNLTDAAIFALAKSGAPITKLQLRECRLIGDASVMALASTRVYED 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/22 (36%)
leucine-rich repeat 157..179 CDD:275381 3/21 (14%)
leucine-rich repeat 180..204 CDD:275381 8/25 (32%)
leucine-rich repeat 205..231 CDD:275381 2/25 (8%)
leucine-rich repeat 232..285 CDD:275381 11/52 (21%)
leucine-rich repeat 286..326 CDD:275381 5/39 (13%)
AMN1 306..>376 CDD:187754 12/78 (15%)
leucine-rich repeat 337..362 CDD:275381 9/24 (38%)
AT2G17020NP_565400.1 F-box 22..60 CDD:279040
leucine-rich repeat 53..87 CDD:275381
leucine-rich repeat 89..111 CDD:275381
leucine-rich repeat 112..137 CDD:275381
leucine-rich repeat 138..168 CDD:275381
leucine-rich repeat 169..215 CDD:275381
leucine-rich repeat 236..260 CDD:275381
AMN1 <246..394 CDD:187754 32/158 (20%)
leucine-rich repeat 261..292 CDD:275381 8/31 (26%)
leucine-rich repeat 294..315 CDD:275381 4/20 (20%)
leucine-rich repeat 328..353 CDD:275381 4/24 (17%)
AMN1 337..497 CDD:187754 51/262 (19%)
leucine-rich repeat 354..379 CDD:275381 3/24 (13%)
leucine-rich repeat 380..404 CDD:275381 12/47 (26%)
leucine-rich repeat 405..429 CDD:275381 7/23 (30%)
leucine-rich repeat 430..455 CDD:275381 10/56 (18%)
leucine-rich repeat 456..481 CDD:275381 8/25 (32%)
leucine-rich repeat 482..509 CDD:275381 10/57 (18%)
leucine-rich repeat 510..529 CDD:275381 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.