DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and kdm2ab

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_001339797.3 Gene:kdm2ab / 799441 ZFINID:ZDB-GENE-101007-5 Length:1263 Species:Danio rerio


Alignment Length:426 Identity:85/426 - (19%)
Similarity:140/426 - (32%) Gaps:156/426 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SCDMFENIYVRSSPLRLSRVVNLEEMIEFSLLETKLFVELSGSDI---------EIIRGG----- 84
            ||     :.|:..|.|..|        :.|.:..||...||...:         ..:|.|     
Zfish   868 SC-----VTVKLQPSRAKR--------DPSTIVPKLEANLSSRSLPPNHKALLRPPLRNGARCSD 919

  Fly    85 -PHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAP-ETSFSNLTY-VSLRRCQLNDE 146
             ||:|     .|     .:.:.|.:.::.....||:....|:. .::|.:.|: ::..|.|.|..
Zfish   920 APHSP-----GD-----RLHVNKSHALSSSSHTLTRRASKNSNLRSNFEDSTHRLTRERIQKNAR 974

  Fly   147 --------------------NLVGWE---------FLTHLET--------------LDLRYNDRL 168
                                |..|||         :||..|.              .|.|...|:
Zfish   975 SERAKSSDSCPSSTFHSGGGNEPGWEKEVWVSVFRYLTRAELCVCMAVCKSWYKWGCDKRLWTRI 1039

  Fly   169 TGSCLMSLPTSLLSLYITGC------------RNLCPNQLIFL-NRIPRLRELRASDLMPGGHWH 220
            :    :|...|:....:||.            .|:...||.:| ||:|.|::|    ::.|.:|.
Zfish  1040 S----LSRSRSMSPQVLTGIIKRQPVTLDLSWANITKKQLSWLINRLPGLKDL----VLSGCNWS 1096

  Fly   221 IYRDLVL-ACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVP 284
            ....|.. :||||..:::|...                             .:.|..:..||:.|
Zfish  1097 SVSALSSPSCPLLRSLDLSWAD-----------------------------GIKDAQIRELLNPP 1132

  Fly   285 FLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYIT 349
                  .||..|...:...|.:..       |::.....|    |.:|::..|..|:||..|...
Zfish  1133 ------GSDNRSQMKNMQCLWLCG-------LEVTEATLR----LIIRHMPLLTRLELSRCPITD 1180

  Fly   350 NEVVIELVIGIP---NLSVLIVQGCPLLTNR--VYL 380
            ..:.:...:|..   .|:.|.:.||..||:|  |||
Zfish  1181 GALNLLSAVGSSTRNTLTHLNLAGCTQLTDRCLVYL 1216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 9/52 (17%)
leucine-rich repeat 157..179 CDD:275381 5/35 (14%)
leucine-rich repeat 180..204 CDD:275381 8/36 (22%)
leucine-rich repeat 205..231 CDD:275381 6/26 (23%)
leucine-rich repeat 232..285 CDD:275381 5/52 (10%)
leucine-rich repeat 286..326 CDD:275381 6/39 (15%)
AMN1 306..>376 CDD:187754 15/72 (21%)
leucine-rich repeat 337..362 CDD:275381 6/27 (22%)
kdm2abXP_001339797.3 JmjC 150..221 CDD:214721
cupin_like 197..297 CDD:304367
zf-CXXC <524..558 CDD:251032
PHD_4 563..624 CDD:293471
F-box-like 1002..1042 CDD:289689 6/43 (14%)
leucine-rich repeat 1036..1060 CDD:275381 5/27 (19%)
leucine-rich repeat 1061..1084 CDD:275381 6/22 (27%)
AMN1 1075..1230 CDD:187754 43/192 (22%)
leucine-rich repeat 1085..1108 CDD:275381 6/26 (23%)
leucine-rich repeat 1109..1142 CDD:275381 9/67 (13%)
leucine-rich repeat 1143..1167 CDD:275381 5/34 (15%)
leucine-rich repeat 1197..1216 CDD:275381 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.