DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and FBXL15

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_005270206.1 Gene:FBXL15 / 79176 HGNCID:28155 Length:387 Species:Homo sapiens


Alignment Length:215 Identity:50/215 - (23%)
Similarity:78/215 - (36%) Gaps:49/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LRLSRVVN-LEEMIEFSLLETKLFVELSGSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTK----V 107
            |||.||.. ...:::..|...:.|        :..:.||..|         |....||.:    :
Human   129 LRLQRVSRAFRSLVQLHLAGLRRF--------DAAQVGPQIP---------RAALARLLRDAEGL 176

  Fly   108 NEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRCQLNDENLVGW------------EFLTHLETL 160
            .|:||    ...::|.     |..:|..|..|..||....|.|.            |....|:.|
Human   177 QELAL----APCHEWL-----SDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCPRLQRL 232

  Fly   161 DLRYNDRLTGSCLMSLP---TSLLSLYITGCRNLCPNQLIFL--NRIPRLRELRASDLMPGGHWH 220
            .|.:.|.:.|..|..|.   .:|..|.:|.||.|....:::|  .|...||.|..:.....|...
Human   233 SLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDAA 297

  Fly   221 IYRDLVLACPLLVMVEISIC 240
            : ::|...||.|..::::.|
Human   298 V-QELARNCPELHHLDLTGC 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/34 (24%)
leucine-rich repeat 157..179 CDD:275381 7/24 (29%)
leucine-rich repeat 180..204 CDD:275381 8/25 (32%)
leucine-rich repeat 205..231 CDD:275381 6/25 (24%)
leucine-rich repeat 232..285 CDD:275381 2/9 (22%)
leucine-rich repeat 286..326 CDD:275381
AMN1 306..>376 CDD:187754
leucine-rich repeat 337..362 CDD:275381
FBXL15XP_005270206.1 F-box 105..>142 CDD:279040 5/12 (42%)
leucine-rich repeat 149..175 CDD:275381 7/42 (17%)
leucine-rich repeat 176..202 CDD:275381 8/34 (24%)
leucine-rich repeat 203..228 CDD:275381 4/24 (17%)
AMN1 <226..>353 CDD:187754 24/92 (26%)
leucine-rich repeat 229..254 CDD:275381 7/24 (29%)
leucine-rich repeat 255..281 CDD:275381 8/25 (32%)
leucine-rich repeat 282..307 CDD:275381 6/25 (24%)
leucine-rich repeat 308..332 CDD:275381 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.