DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and SKP2

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_005974.2 Gene:SKP2 / 6502 HGNCID:10901 Length:424 Species:Homo sapiens


Alignment Length:243 Identity:50/243 - (20%)
Similarity:89/243 - (36%) Gaps:74/243 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PMFSHFEDF-IRLMSI---------------RLTKVNEIALEGFQL------TQYKWFNAPETSF 130
            |:..||..| ::.|.:               :.:|:..::|||.:|      |..|..|....:.
Human   173 PLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNL 237

  Fly   131 SNLTYVS-------LRRCQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLPTSLLSLYITGC 188
            |..:..|       |..|...||..:.|.|         .:.::.....:..:..::..|.::|.
Human   238 SGCSGFSEFALQTLLSSCSRLDELNLSWCF---------DFTEKHVQVAVAHVSETITQLNLSGY 293

  Fly   189 RNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDE--YRLGE 251
            |                :.|:.|||         ..||..||.||.:::|...:.:::  ....:
Human   294 R----------------KNLQKSDL---------STLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ 333

  Fly   252 LRYLQSLVIKAHSTDTIRC-KVSDWMLISLLDVPFLRNL-MFSDAPSG 297
            |.|||.|.:.       || .:....|:.|.::|.|:.| :|...|.|
Human   334 LNYLQHLSLS-------RCYDIIPETLLELGEIPTLKTLQVFGIVPDG 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 7/29 (24%)
leucine-rich repeat 157..179 CDD:275381 0/21 (0%)
leucine-rich repeat 180..204 CDD:275381 3/23 (13%)
leucine-rich repeat 205..231 CDD:275381 7/25 (28%)
leucine-rich repeat 232..285 CDD:275381 12/55 (22%)
leucine-rich repeat 286..326 CDD:275381 5/13 (38%)
AMN1 306..>376 CDD:187754
leucine-rich repeat 337..362 CDD:275381
SKP2NP_005974.2 Mediates interaction with hepatitis C virus non-structural protein NS5A. /evidence=ECO:0000269|PubMed:27194766 1..220 10/46 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..73
Nuclear localization signal. /evidence=ECO:0000269|PubMed:22770219 67..73
F-box-like 97..141 CDD:403981
leucine-rich repeat 183..207 CDD:275381 1/23 (4%)
AMN1 193..>345 CDD:187754 35/192 (18%)
leucine-rich repeat 208..231 CDD:275381 6/22 (27%)
LRR 3. /evidence=ECO:0000269|PubMed:11099048 210..234 7/23 (30%)
leucine-rich repeat 232..257 CDD:275381 4/24 (17%)
LRR 4. /evidence=ECO:0000269|PubMed:11099048 235..257 4/21 (19%)
leucine-rich repeat 258..284 CDD:275381 4/34 (12%)
LRR 5. /evidence=ECO:0000269|PubMed:11099048 258..284 4/34 (12%)
leucine-rich repeat 285..311 CDD:275381 10/50 (20%)
LRR 6. /evidence=ECO:0000269|PubMed:11099048 286..308 9/46 (20%)
LRR 7. /evidence=ECO:0000269|PubMed:11099048 309..330 5/20 (25%)
leucine-rich repeat 312..336 CDD:275381 4/23 (17%)
LRR 8. /evidence=ECO:0000269|PubMed:11099048 334..356 8/28 (29%)
leucine-rich repeat 337..356 CDD:275381 6/25 (24%)
LRR 9. /evidence=ECO:0000269|PubMed:11099048 359..378 6/16 (38%)
leucine-rich repeat 365..392 CDD:275381 4/10 (40%)
LRR 10. /evidence=ECO:0000269|PubMed:11099048 380..401
Mediates interaction with IFI27. /evidence=ECO:0000269|PubMed:27194766 402..424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152995
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.