DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and FBXL17

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_005272105.1 Gene:FBXL17 / 64839 HGNCID:13615 Length:712 Species:Homo sapiens


Alignment Length:450 Identity:86/450 - (19%)
Similarity:156/450 - (34%) Gaps:157/450 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISFSVISRF------DF-FWLDVLKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVNLEEMIE 61
            :|.|::.::      || ||    |||||.||..  .:.::.|.|..||           :.:||
Human   343 LSASLVCKYWRDLCLDFQFW----KQLDLSSRQQ--VTDELLEKIASRS-----------QNIIE 390

  Fly    62 FSLLETK---------LFVELSG------------SDIEIIRGGPHTPMFS-------------- 91
            .::.:.:         |..:..|            ||..||....|.|:..              
Human   391 INISDCRSMSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEG 455

  Fly    92 --------------HF-------EDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTY 135
                          ||       ::.:.:::....|:..|.::..:|...:...|.......|.|
Human   456 LKQLGSKCRELKDIHFGQCYKISDEGMIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPELQY 520

  Fly   136 VSLRRCQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLN 200
            |....|.:..:.::....|.:|.:||||:...|....:|.:        :..|:||....|..  
Human   521 VGFMGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVMEI--------VKRCKNLSSLNLCL-- 575

  Fly   201 RIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAHST 265
                             :| |..|   .|     ||:    :.::...|.|| ||          
Human   576 -----------------NW-IIND---RC-----VEV----IAKEGQNLKEL-YL---------- 599

  Fly   266 DTIRCKVSDWMLISL---------LDVPFLRNLMFSDAPSGFVSANALSI----ISRFRQLRVLK 317
              :.||::|:.||::         :||.:.:.:  :|..:..::.::.|:    :.|..::||  
Human   600 --VSCKITDYALIAIGRYSMTIETVDVGWCKEI--TDQGATLIAQSSKSLRYLGLMRCDKVRV-- 658

  Fly   318 MPNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGC-PLLTN 376
                .|:....|.:..:..|.:..||.|  |:..|...|.|....:..:|...| |...|
Human   659 ----DYQVVCFLHISIVNSLMSYPLSFS--ISTPVYYILYIHFICIYAIIAMHCLPAFVN 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 5/22 (23%)
leucine-rich repeat 157..179 CDD:275381 7/21 (33%)
leucine-rich repeat 180..204 CDD:275381 4/23 (17%)
leucine-rich repeat 205..231 CDD:275381 4/25 (16%)
leucine-rich repeat 232..285 CDD:275381 14/61 (23%)
leucine-rich repeat 286..326 CDD:275381 6/43 (14%)
AMN1 306..>376 CDD:187754 16/74 (22%)
leucine-rich repeat 337..362 CDD:275381 8/24 (33%)
FBXL17XP_005272105.1 F-box-like 321..368 CDD:289689 10/28 (36%)
leucine-rich repeat 362..387 CDD:275381 12/41 (29%)
leucine-rich repeat 388..413 CDD:275381 3/24 (13%)
AMN1 411..573 CDD:187754 28/169 (17%)
leucine-rich repeat 414..439 CDD:275381 5/24 (21%)
leucine-rich repeat 440..465 CDD:275381 0/24 (0%)
leucine-rich repeat 466..491 CDD:275381 2/24 (8%)
leucine-rich repeat 492..517 CDD:275381 3/24 (13%)
leucine-rich repeat 518..541 CDD:275381 5/22 (23%)
leucine-rich repeat 542..567 CDD:275381 8/32 (25%)
AMN1 547..>652 CDD:187754 28/159 (18%)
leucine-rich repeat 568..593 CDD:275381 8/56 (14%)
leucine-rich repeat 594..615 CDD:275381 10/33 (30%)
leucine-rich repeat 619..641 CDD:275381 3/23 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153039
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.