DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl20

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_017453008.1 Gene:Fbxl20 / 64039 RGDID:621722 Length:453 Species:Rattus norvegicus


Alignment Length:262 Identity:60/262 - (22%)
Similarity:97/262 - (37%) Gaps:88/262 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 TSFSNLTYVSLRR-CQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLPT---SLLSLYITGC 188
            ||.:|::..:|.. |.|             ||.|::.:.|::|...:.:|..   .|.:|::.||
  Rat   171 TSITNMSLKALSEGCPL-------------LEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGC 222

  Fly   189 RNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELR 253
            ..|....|.::                |.|          ||.||.:.:..|....||..:...|
  Rat   223 TQLEDEALKYI----------------GAH----------CPELVTLNLQTCLQITDEGLITICR 261

  Fly   254 ---YLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRV 315
               .||||.....|      .::|.:|          |.:..:.|                :||:
  Rat   262 GCHKLQSLCASGCS------NITDAIL----------NALGQNCP----------------RLRI 294

  Fly   316 LKMPNQPYRPNDLLRL------RNLTFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLL 374
            |::.    |.:.|..:      ||...||.:||.....||:..:|:|.|..|.|.||.:..|.|:
  Rat   295 LEVA----RCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELI 355

  Fly   375 TN 376
            |:
  Rat   356 TD 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 3/23 (13%)
leucine-rich repeat 157..179 CDD:275381 6/24 (25%)
leucine-rich repeat 180..204 CDD:275381 6/23 (26%)
leucine-rich repeat 205..231 CDD:275381 3/25 (12%)
leucine-rich repeat 232..285 CDD:275381 13/55 (24%)
leucine-rich repeat 286..326 CDD:275381 6/39 (15%)
AMN1 306..>376 CDD:187754 22/75 (29%)
leucine-rich repeat 337..362 CDD:275381 9/24 (38%)
Fbxl20XP_017453008.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.