DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxo39

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_006533964.2 Gene:Fbxo39 / 628100 MGIID:3505735 Length:480 Species:Mus musculus


Alignment Length:292 Identity:63/292 - (21%)
Similarity:94/292 - (32%) Gaps:86/292 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LEGFQLTQYKWFNAPETSFSNLTYVSLRRCQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSL 176
            ||..::.....:||..|....:|...|..|.....|.:....:.|||...|.:.:.:.||.:.||
Mouse   126 LEHLEIKFLNPYNAVLTKKFQVTMRGLLSCLGKSNNRLRSLSIQHLELDRLVWRNSIRGSLIKSL 190

  Fly   177 P------------TSLLSLYIT---GCRNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIYRDLV 226
            .            .||....:|   ||..|  |.|.::.......||...|.. ..|..:|....
Mouse   191 SFFLKKMGKHLDHLSLKGARLTVEQGCHIL--NSLSYMQNENMASELNIEDFF-SHHLAVYGSSQ 252

  Fly   227 LACPLLVMVEISICSLNRD-----------EYRLGELRYLQSLVIKAHSTDTIRCKVSD------ 274
            ....:.....::..:||.:           |...|.||           |..|:|.|.|      
Mouse   253 FNKAMATFRNLTFLTLNYNCISDELLETLSENNAGTLR-----------TMNIKCHVHDPHGQVV 306

  Fly   275 ----WMLI----SLLDVPF----------LRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQ 321
                |..:    |.|.|.|          |..::..:.|     ..::|:.|.:     ...|:.
Mouse   307 WGMSWAKLARQASNLKVNFFFERVMKYERLARILLQEIP-----VRSISLRSCY-----FSDPDW 361

  Fly   322 PYRP--NDLL-----RLRNLTF-----LETLD 341
            ..||  .|||     .|:.|||     .|:||
Mouse   362 SMRPTLTDLLPTFRNTLQKLTFEFNNNHESLD 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 4/22 (18%)
leucine-rich repeat 157..179 CDD:275381 7/33 (21%)
leucine-rich repeat 180..204 CDD:275381 7/26 (27%)
leucine-rich repeat 205..231 CDD:275381 5/25 (20%)
leucine-rich repeat 232..285 CDD:275381 15/77 (19%)
leucine-rich repeat 286..326 CDD:275381 7/41 (17%)
AMN1 306..>376 CDD:187754 14/48 (29%)
leucine-rich repeat 337..362 CDD:275381 3/5 (60%)
Fbxo39XP_006533964.2 F-box-like 53..94 CDD:372399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.