DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and fbxl3l

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_693270.2 Gene:fbxl3l / 564855 ZFINID:ZDB-GENE-130530-598 Length:448 Species:Danio rerio


Alignment Length:235 Identity:56/235 - (23%)
Similarity:90/235 - (38%) Gaps:58/235 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DVLKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVN----LEEM-IEFSLLETKLFVELSGSD 77
            |.||.|.:       :||.       ..||..:..|.:    |.|: :.:.||..:|.:.||...
Zfish   218 DTLKLLKM-------SSCP-------HVSPAGILCVADQCHGLRELALNYHLLSDELLLALSSEK 268

  Fly    78 --------IEIIRGGP-----HTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETS 129
                    |:::...|     ||...|.::..||    ...:||.:........:::.|...||.
Zfish   269 HVHLEHLRIDVVSENPGQTQFHTIKKSSWDALIR----HSPQVNIVMYFFLYEEEFEPFFREETP 329

  Fly   130 FSNLTY---VS---LRRCQLNDENLVGWEFLTH-LETLD---LRYNDRLTGSCLMSLPTSLLSLY 184
            .::|.:   ||   |.|..||...||......: ||.||   :|..||    |     .||.::.
Zfish   330 VTHLYFGRAVSKDMLGRIGLNCPRLVELVVCANGLEPLDEELIRIADR----C-----KSLTAIG 385

  Fly   185 ITGCRNLCPNQLIFLNRI-PRLRELRASD--LMPGGHWHI 221
            :..|...|...:.|:... .||.:|...:  |:|...::|
Zfish   386 LGECEVTCSGFMEFVKMCGGRLSQLSIMEEVLIPDNTYNI 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 9/28 (32%)
leucine-rich repeat 157..179 CDD:275381 8/24 (33%)
leucine-rich repeat 180..204 CDD:275381 4/24 (17%)
leucine-rich repeat 205..231 CDD:275381 5/19 (26%)
leucine-rich repeat 232..285 CDD:275381
leucine-rich repeat 286..326 CDD:275381
AMN1 306..>376 CDD:187754
leucine-rich repeat 337..362 CDD:275381
fbxl3lXP_693270.2 F-box-like 56..99 CDD:289689
leucine-rich repeat 194..218 CDD:275381 56/235 (24%)
leucine-rich repeat 220..245 CDD:275381 8/38 (21%)
leucine-rich repeat 246..271 CDD:275381 7/24 (29%)
leucine-rich repeat 272..306 CDD:275381 7/37 (19%)
leucine-rich repeat 307..353 CDD:275381 12/45 (27%)
AMN1 <347..>412 CDD:187754 20/73 (27%)
leucine-rich repeat 354..380 CDD:275381 10/34 (29%)
leucine-rich repeat 381..403 CDD:275381 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588084
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.