DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and FBXL12

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_016882401.1 Gene:FBXL12 / 54850 HGNCID:13611 Length:343 Species:Homo sapiens


Alignment Length:216 Identity:48/216 - (22%)
Similarity:79/216 - (36%) Gaps:61/216 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 LMSLPTSLLSLYITGC--------RNLCPNQL-----IFLNRIPRLRELRASDLMPGGHWHIYRD 224
            :.|||::|.:|.:..|        :...|..|     |.|:|:|..|:.....|.   .:...|.
Human   136 ITSLPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLT---RFRALRS 197

  Fly   225 LVLACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNL 289
            |||.....| .|..:      :..|.||.|||.|       :.:.|.:|                
Human   198 LVLGGTYRV-TETGL------DAGLQELSYLQRL-------EVLGCTLS---------------- 232

  Fly   290 MFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEV-- 352
                     ..:..|:|....|.:|.:::..:......|..|..:..||:|.| ..|.:|.|:  
Human   233 ---------ADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCL-QGPLVTPEMPS 287

  Fly   353 ---VIELVIGIPNLSVLIVQG 370
               ::...:.:|.|.||.:||
Human   288 PTEILSSCLTMPKLRVLELQG 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381 3/5 (60%)
leucine-rich repeat 180..204 CDD:275381 8/36 (22%)
leucine-rich repeat 205..231 CDD:275381 6/25 (24%)
leucine-rich repeat 232..285 CDD:275381 11/52 (21%)
leucine-rich repeat 286..326 CDD:275381 4/39 (10%)
AMN1 306..>376 CDD:187754 18/70 (26%)
leucine-rich repeat 337..362 CDD:275381 7/29 (24%)
FBXL12XP_016882401.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.