DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl3

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001347270.1 Gene:Fbxl3 / 50789 MGIID:1354702 Length:428 Species:Mus musculus


Alignment Length:199 Identity:41/199 - (20%)
Similarity:71/199 - (35%) Gaps:62/199 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 PRLRELRASDLMPGGHWHIYRDLVL----ACPLLVMVEIS-ICSLNRDEYRLGEL---------- 252
            ||..:.|:   .|....::.:|:||    ..|||.....| :|......:.:.:|          
Mouse    24 PRTTQERS---QP
CDWGNLLQDIVLHVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQ 85

  Fly   253 ---RYLQSL-------VIKAHS------------------------TDTIRCKVSDWMLISLLDV 283
               .||::.       :||.||                        :..:.|.:....|||....
Mouse    86 PATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARP 150

  Fly   284 PFLRNLMFSDAP-SGFVSANALSIISRFRQLRVLKMPNQPYRPNDL--LRLRNLTFLETLDLSNS 345
            .|:      |.| |.|:||..:..::. :.|..||:.:.|.....|  |...|...|:.|.:|:.
Mouse   151 SFM------DLPKSHFISALTVVFVNS-KSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSC 208

  Fly   346 PYIT 349
            |:::
Mouse   209 PHVS 212

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381