DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and fbxl22

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001013297.1 Gene:fbxl22 / 503591 ZFINID:ZDB-GENE-050227-1 Length:227 Species:Danio rerio


Alignment Length:189 Identity:43/189 - (22%)
Similarity:69/189 - (36%) Gaps:51/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 RDLVLACPLLVMVEI-----------SICSLNRDEYRLG-ELRYLQSLVIKAHSTDTIRCKVSDW 275
            |.|.|.|..|..|.:           |.|.|.||.:.:| .|||   |.:..||:....|.:..|
Zfish    24 RSLSLTCVRLRQVFLDPQLWTLLHF
WSPCELRRDNFVVGSSLRY---LAVCWHSSRVKVCNIEHW 85

  Fly   276 MLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRLRNLTFLETL 340
            |     ...|.::|          .:...|.:|.|.:......||                |.:|
Zfish    86 M-----KTTFQKDL----------CSKHESFVSDFLEHVCNMCPN----------------LISL 119

  Fly   341 DLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLLTNRVYLDAELASKKRSNGNMVKVQL 399
            .||...:|.:..||:::.....|..|.::.|..:|     |:.|.:......|:.:|::
Zfish   120 TLSGCGHIMDNNVIKVLQSCRRLRSLSLENCARIT-----DSVLKAAVEHGHNLTEVRV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381
leucine-rich repeat 180..204 CDD:275381
leucine-rich repeat 205..231 CDD:275381 4/7 (57%)
leucine-rich repeat 232..285 CDD:275381 17/64 (27%)
leucine-rich repeat 286..326 CDD:275381 6/39 (15%)
AMN1 306..>376 CDD:187754 14/69 (20%)
leucine-rich repeat 337..362 CDD:275381 7/24 (29%)
fbxl22NP_001013297.1 F-box-like 9..48 CDD:289689 6/23 (26%)
AMN1 <103..>191 CDD:187754 19/92 (21%)
leucine-rich repeat 116..141 CDD:275381 7/24 (29%)
leucine-rich repeat 142..167 CDD:275381 6/29 (21%)
leucine-rich repeat 168..187 CDD:275381 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.