DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl16

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_038942467.1 Gene:Fbxl16 / 494223 RGDID:1309127 Length:488 Species:Rattus norvegicus


Alignment Length:398 Identity:79/398 - (19%)
Similarity:145/398 - (36%) Gaps:154/398 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FDFFWLDVLKQLDLKSRISFAASCDMFENIY-----VRSSPLRLSRVVN--LEEMIEFSLLETKL 69
            |:.|.|..:..||:         |:..:|..     |::..|:.|.:.:  ||.|:|  .::..:
  Rat   168 FEGFCLVGVSDLDI---------CEFIDNYSLSKKGVKAMSLKRSTITDAGLEVMLE--QMQGVV 221

  Fly    70 FVELSGSDIEIIRGGPHTPMFSHF------------EDFIRLMSIRLTKVNEIALEGFQLTQ--Y 120
            .:||||.: :....|..:.:.:..            :|.|..:|..|..:.|::|:.:.:|.  .
  Rat   222 RLELSGCN-DFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTAL 285

  Fly   121 KWFNAPETSFSNLTYVSLRRCQLNDENLVGWEFLTHLETLDLRYNDRLTG--SCLMSLPTSLLSL 183
            .:|.|.:...::.  :.|..|         ||...|             |  :.:.||| :|.||
  Rat   286 AYFTARQGHSTHT--LRLLSC---------WEITNH-------------GVVNVVHSLP-NLTSL 325

  Fly   184 YITGCRNLCPN--QLIFLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLL--VMVEISICSLNR 244
            .::||..:..:  :|:..|    ||:||:.||    .|         ||.:  :.:|...|.|:|
  Rat   326 SLSGCSKVTDDGVELVAEN----LRKLRSLDL----SW---------CPRITDMALEYVACDLHR 373

  Fly   245 DEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISR 309
                      |:.||:.       ||                                       
  Rat   374 ----------LEELVLD-------RC--------------------------------------- 382

  Fly   310 FRQLRVLKMPNQPYRPNDLLRLRN--LTFLETLDLSNSPYI-----TNEVVIELVIGIPNLSVLI 367
                      ..||.|...:|:.:  |::|.|:....|.|:     ..:..::.::.:.:|.:|.
  Rat   383 ----------THPYTPGWCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLAMRSLRLLS 437

  Fly   368 VQGCPLLT 375
            :.||||||
  Rat   438 LAGCPLLT 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 4/22 (18%)
leucine-rich repeat 157..179 CDD:275381 4/23 (17%)
leucine-rich repeat 180..204 CDD:275381 7/25 (28%)
leucine-rich repeat 205..231 CDD:275381 8/25 (32%)
leucine-rich repeat 232..285 CDD:275381 9/54 (17%)
leucine-rich repeat 286..326 CDD:275381 2/39 (5%)
AMN1 306..>376 CDD:187754 17/77 (22%)
leucine-rich repeat 337..362 CDD:275381 4/29 (14%)
Fbxl16XP_038942467.1 leucine-rich repeat 195..219 CDD:275381 7/25 (28%)
AMN1 201..422 CDD:187754 62/331 (19%)
leucine-rich repeat 220..243 CDD:275381 5/23 (22%)
leucine-rich repeat 244..269 CDD:275381 4/24 (17%)
leucine-rich repeat 270..321 CDD:275381 14/75 (19%)
leucine-rich repeat 322..347 CDD:275381 8/28 (29%)
leucine-rich repeat 348..373 CDD:275381 10/37 (27%)
leucine-rich repeat 374..407 CDD:275381 12/88 (14%)
leucine-rich repeat 408..427 CDD:275381 2/18 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.