Sequence 1: | NP_573291.1 | Gene: | CG15056 / 32824 | FlyBaseID: | FBgn0030918 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_795933.2 | Gene: | Fbxl7 / 448987 | MGIID: | 3052506 | Length: | 491 | Species: | Mus musculus |
Alignment Length: | 291 | Identity: | 69/291 - (23%) |
---|---|---|---|
Similarity: | 111/291 - (38%) | Gaps: | 86/291 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 157 LETLDLRYNDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLNR-IPRLRELRASDLMPGGHWH 220
Fly 221 IYR----DLVLACPLLVMVEISIC------SLNRD-EYRLGEL-------RYLQSL--------- 258
Fly 259 --VIKAHSTDTI-----RC-KVSD----WMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFR 311
Fly 312 -QLRVLKMPNQPYRPNDL-----------LR------------------LRNLTFLETLDLSNSP 346
Fly 347 YITNEVVIELVIGIPNLSVLIVQGCPLLTNR 377 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15056 | NP_573291.1 | leucine-rich repeat | 133..156 | CDD:275381 | |
leucine-rich repeat | 157..179 | CDD:275381 | 6/21 (29%) | ||
leucine-rich repeat | 180..204 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 205..231 | CDD:275381 | 9/29 (31%) | ||
leucine-rich repeat | 232..285 | CDD:275381 | 19/87 (22%) | ||
leucine-rich repeat | 286..326 | CDD:275381 | 12/40 (30%) | ||
AMN1 | 306..>376 | CDD:187754 | 19/99 (19%) | ||
leucine-rich repeat | 337..362 | CDD:275381 | 5/24 (21%) | ||
Fbxl7 | NP_795933.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..79 | ||
F-box-like | 114..160 | CDD:289689 | |||
leucine-rich repeat | 129..151 | CDD:275381 | |||
leucine-rich repeat | 154..187 | CDD:275381 | 4/16 (25%) | ||
AMN1 | <185..366 | CDD:187754 | 51/196 (26%) | ||
LRR 1 | 185..210 | 9/29 (31%) | |||
leucine-rich repeat | 188..213 | CDD:275381 | 6/24 (25%) | ||
LRR 2 | 211..236 | 9/29 (31%) | |||
leucine-rich repeat | 214..234 | CDD:275381 | 7/24 (29%) | ||
LRR 3 | 237..262 | 8/24 (33%) | |||
leucine-rich repeat | 240..273 | CDD:275381 | 8/32 (25%) | ||
LRR 4 | 271..296 | 4/24 (17%) | |||
leucine-rich repeat | 274..299 | CDD:275381 | 6/24 (25%) | ||
AMN1 | 297..464 | CDD:187754 | 32/154 (21%) | ||
LRR 5 | 297..322 | 4/24 (17%) | |||
leucine-rich repeat | 300..325 | CDD:275381 | 4/24 (17%) | ||
LRR 6 | 323..348 | 8/29 (28%) | |||
leucine-rich repeat | 326..351 | CDD:275381 | 8/29 (28%) | ||
LRR 7 | 349..374 | 5/25 (20%) | |||
leucine-rich repeat | 352..377 | CDD:275381 | 5/25 (20%) | ||
LRR 8 | 375..400 | 2/24 (8%) | |||
leucine-rich repeat | 378..403 | CDD:275381 | 3/24 (13%) | ||
LRR 9 | 401..426 | 6/24 (25%) | |||
leucine-rich repeat | 404..429 | CDD:275381 | 5/24 (21%) | ||
LRR 10 | 427..452 | 5/18 (28%) | |||
leucine-rich repeat | 430..453 | CDD:275381 | 4/15 (27%) | ||
leucine-rich repeat | 456..480 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167843168 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |