DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and FipoQ

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster


Alignment Length:447 Identity:85/447 - (19%)
Similarity:157/447 - (35%) Gaps:165/447 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MFENIYVRS--SPLRLSRVVNLEEMIEFSLLETKLFVELSGSDIEIIRGGPHT---------PMF 90
            :::|:.:|.  |.|.:..:..|.::|......|..::||   .||:|   .||         |..
  Fly    73 LWKNVSLRPEVSGLHVGSLEMLLQLISVRFGPTLRYIEL---PIELI---THTVLHELSAKCPNL 131

  Fly    91 SH----------FEDF---------IRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYV 136
            :|          ..||         :|.|.:.|::|  |.:|||....|.:.|..|......|| 
  Fly   132 THMLLDFSTAMQLHDFSEMQAFPTKLRYMCVCLSEV--IFMEGFMRKIYNFINGLEVLHLIGTY- 193

  Fly   137 SLRRCQLNDE---------------------NLVGWEFL--TH----------LETLDLRYNDRL 168
              .:|:..:|                     ||.|..|:  :|          ||.|.:.:.:::
  Fly   194 --EKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKV 256

  Fly   169 TGS-------------CLMSLPTSLLSLYITGCR-NLCPNQLIFLNRIPRLRELRASDLMPGGHW 219
            |||             ||:...|||.|.::.... :.|..|.:         ::.|:||      
  Fly   257 TGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQEL---------DITATDL------ 306

  Fly   220 HIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWM-------L 277
                          ..|..:..|:    |:..|::|.:..|...:...::    .||       |
  Fly   307 --------------STECLVDMLS----RIPSLKFLSAGQINGFNDSVLK----QWMESGTTRSL 349

  Fly   278 ISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLLRLRNLTFLETLDL 342
            || ||:         |:.........|..|.|           |.::            |....|
  Fly   350 IS-LDL---------DSSDNISDEGLLKFIQR-----------QGHQ------------LSACCL 381

  Fly   343 SNSPYITNEVVIELVIGIPNLSVLIVQGCPLLTNRVYLDAELASKKRSNGNMVKVQL 399
            |..|:||:::.:.::..:.|..::::.....|...:::|..:.:...:.||:.:::|
  Fly   382 SGMPHITDQLWMSILPLLGNCKIIVMGTAEKLGVNIHVDQLMDTIASNCGNLERLEL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/45 (18%)
leucine-rich repeat 157..179 CDD:275381 8/34 (24%)
leucine-rich repeat 180..204 CDD:275381 4/24 (17%)
leucine-rich repeat 205..231 CDD:275381 3/25 (12%)
leucine-rich repeat 232..285 CDD:275381 13/59 (22%)
leucine-rich repeat 286..326 CDD:275381 5/39 (13%)
AMN1 306..>376 CDD:187754 11/69 (16%)
leucine-rich repeat 337..362 CDD:275381 6/24 (25%)
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 1/6 (17%)
leucine-rich repeat 131..156 CDD:275381 3/24 (13%)
leucine-rich repeat 157..175 CDD:275381 8/19 (42%)
leucine-rich repeat 219..244 CDD:275381 5/24 (21%)
leucine-rich repeat 245..270 CDD:275381 6/24 (25%)
leucine-rich repeat 271..295 CDD:275381 6/23 (26%)
leucine-rich repeat 296..320 CDD:275381 7/56 (13%)
leucine-rich repeat 321..348 CDD:275381 5/30 (17%)
leucine-rich repeat 349..375 CDD:275381 10/46 (22%)
leucine-rich repeat 376..403 CDD:275381 7/26 (27%)
leucine-rich repeat 405..432 CDD:275381 2/26 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457986
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.