DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and CG5003

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster


Alignment Length:323 Identity:72/323 - (22%)
Similarity:120/323 - (37%) Gaps:87/323 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KQLDLKSRISFAASCD--MFENIYVRSSPLRLSRVVNLEEMIEFSLLETKLF--VELSGSD---- 77
            :.||.::..:....||  :|| |:.......:..|::.....|..||:.:.:  ::||...    
  Fly    59 ESLDRETECNLMDFCDELLFE-IFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMG 122

  Fly    78 -IEIIRG------------GPHTPMFSH----FEDFIRLMSI---RLTKVNEIALEGFQLTQYKW 122
             :|.|.|            ||  |...|    |..|.:.:|.   |:.::..:.|||..| .:::
  Fly   123 ILEEILGRATEKTHTIKICGP--PSSQHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSL-DFEY 184

  Fly   123 FNAPETSFSNLTYVSLRRCQLNDENL-VG-------WEFLTHLETL-DLRYNDR-------LTGS 171
            .:..|..      .:|||.:|.|.:: ||       :....||..| ||...|.       :.| 
  Fly   185 IHITEFP------ATLRRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMG- 242

  Fly   172 CLMSLPTSLLSLYITGCRNLC---------------PNQLIFLNRIPRLRELRASDLMPGGHWHI 221
             |..|| ||..|.:.||:.||               ..:.:.|.:.|    :..|||........
  Fly   243 -LSKLP-SLRRLSLKGCQALCKFVPYGSMAARFGFQKLESLDLRQTP----INNSDLQCFSAIEN 301

  Fly   222 YRDLVLACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAHSTD---TIR--------CKVS 273
            .::|:|..|.::..:.::...|.:.....|....|...:|..|.|   |.|        |||:
  Fly   302 LKELLLESPQILHSKQAVAKKNTNGNATDEAASPQPDSLKVLSDDEPSTSRAAMEHLRACKVA 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 7/30 (23%)
leucine-rich repeat 157..179 CDD:275381 9/29 (31%)
leucine-rich repeat 180..204 CDD:275381 7/38 (18%)
leucine-rich repeat 205..231 CDD:275381 5/25 (20%)
leucine-rich repeat 232..285 CDD:275381 11/53 (21%)
leucine-rich repeat 286..326 CDD:275381
AMN1 306..>376 CDD:187754
leucine-rich repeat 337..362 CDD:275381
CG5003NP_651593.1 F-box 68..114 CDD:279040 9/46 (20%)
leucine-rich repeat 610..635 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457991
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.