DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and CG14891

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster


Alignment Length:374 Identity:124/374 - (33%)
Similarity:202/374 - (54%) Gaps:18/374 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DFFWLDVLKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVNLEEMIEFSLLETKLFVELSGSD 77
            |..|..||..|.|..|::|||||:.|:.||...|. |::.|:|::::...:....|..:.|||..
  Fly   118 DDIWWKVLDYLSLNERLNFAASCERFQAIYELDSH-RINHVLNMKDVCTLTHRVIKRLMLLSGKH 181

  Fly    78 IEIIRGGPHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLT-----QYKWFNAPETSFSNLTYVS 137
            |..:.|||..|.:.:..:|::|:.:....:.|::.  |:::     ....|:. .....|:|.:|
  Fly   182 IHCVTGGPLHPNWPYLTEFVQLLGVSCPNLTELSF--FKISVSLAHMTHLFDG-ANGLINITNIS 243

  Fly   138 LRRCQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLNRI 202
            ||||.|.|.::...:.|:.|::||:|.|..:.|..|.|||.||..|.::||.:|.|..||.|..:
  Fly   244 LRRCNLKDAHIYCLQMLSKLKSLDIRENFSIKGDSLKSLPISLEILNVSGCVDLSPKCLIQLAAL 308

  Fly   203 PRLRELRASDLMP-GGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAHSTD 266
            ..|||||...::. .....:|..|...||:|.::|::..   .:..:||.|..|.:|||  ||:.
  Fly   309 SHLRELRCPGIVKFAKDNELYGRLAHYCPMLEVLELTDF---MNVIQLGGLSRLHTLVI--HSSA 368

  Fly   267 TIRCKVSDWMLISLLDVPFLRNLMFSDA--PSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLL 329
            .:...|::.:|.|:.:...||:|...|:  |....|.: |||.|:.::||.|.:.||.:....|:
  Fly   369 QLDYHVNNVLLTSIAESYSLRHLEILDSFGPMSDTSFD-LSIFSQLKELRTLILHNQNFTTLHLM 432

  Fly   330 RLRNLTFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLLTNRV 378
            .|:.|:.||.||||.||.::||||.:|...:..|..|.|..|||:|.::
  Fly   433 GLQKLSTLEFLDLSGSPNLSNEVVAKLTKSLSGLRRLKVDFCPLITRQL 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 9/22 (41%)
leucine-rich repeat 157..179 CDD:275381 10/21 (48%)
leucine-rich repeat 180..204 CDD:275381 9/23 (39%)
leucine-rich repeat 205..231 CDD:275381 8/26 (31%)
leucine-rich repeat 232..285 CDD:275381 14/52 (27%)
leucine-rich repeat 286..326 CDD:275381 15/41 (37%)
AMN1 306..>376 CDD:187754 29/69 (42%)
leucine-rich repeat 337..362 CDD:275381 13/24 (54%)
CG14891NP_650560.1 RRM_6 25..91 CDD:290958
AMN1 <199..352 CDD:187754 46/158 (29%)
leucine-rich repeat 211..237 CDD:275381 3/28 (11%)
leucine-rich repeat 239..262 CDD:275381 9/22 (41%)
leucine-rich repeat 263..285 CDD:275381 10/21 (48%)
leucine-rich repeat 286..338 CDD:275381 17/51 (33%)
leucine-rich repeat 339..387 CDD:275381 14/52 (27%)
leucine-rich repeat 388..415 CDD:275381 10/27 (37%)
leucine-rich repeat 416..439 CDD:275381 8/22 (36%)
leucine-rich repeat 440..465 CDD:275381 13/24 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457996
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019540
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.