DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl7

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster


Alignment Length:379 Identity:87/379 - (22%)
Similarity:148/379 - (39%) Gaps:81/379 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FFWLDVLKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVNLE-EMIEFSLLETKLFVELSGSD 77
            |.|||..:..::      |..|..||::..|  |: |.:|::|. |.:........:|.:|.|..
  Fly   413 FSWLDSCELCNV------ARVCRRFEHLAWR--PI-LWKVISLRGEHLNGDKTLKMIFRQLCGQS 468

  Fly    78 I-----EIIRGGPHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYVS 137
            .     |:.|                   :.|.....|:.:|.||...:   .||     ||::.
  Fly   469 CNGACPEVER-------------------VMLADGCRISDKGLQLLTRR---CPE-----LTHLQ 506

  Fly   138 LRRC-QLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLPTSLLSLYITGC---RNLCPNQLIF 198
            |:.| .:.::.||  |.||               .|     ::|..|.:|||   .::.||..:.
  Fly   507 LQTCVDITNQALV--EALT---------------KC-----SNLQHLDVTGCSQVSSISPNPHME 549

  Fly   199 LNRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYLQSLVIKAH 263
            ..|...|:.|..:|.|......: :.:|..||.||.:.:..|....|    ..|:::.|..:...
  Fly   550 PPRRLLLQYLDLTDCMAIDDMGL-KIVVKNCPQLVYLYLRRCIQVTD----AGLKFVPSFCVSLK 609

  Fly   264 STDTIRC-KVSDWMLISLLDV-PFLRNLMFSDAPSGFVSANALSIIS-RFRQLRVLKMPNQPYRP 325
            ......| .::|:.|..|..: ..||.|  |.|....||...|.:|: |..:||.|.........
  Fly   610 ELSVSDCLNITDFGLYELAKLGAALRYL--SVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVS 672

  Fly   326 NDLLRL--RNLTFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLLTNR 377
            :|.:.:  |:...|..||:.... :::..:..|....|||..|.::.|.::|:|
  Fly   673 DDSITVLARSCPRLRALDIGKCD-VSDAGLRALAESCPNLKKLSLRSCDMITDR 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/23 (35%)
leucine-rich repeat 157..179 CDD:275381 1/21 (5%)
leucine-rich repeat 180..204 CDD:275381 8/26 (31%)
leucine-rich repeat 205..231 CDD:275381 6/25 (24%)
leucine-rich repeat 232..285 CDD:275381 10/54 (19%)
leucine-rich repeat 286..326 CDD:275381 13/40 (33%)
AMN1 306..>376 CDD:187754 16/72 (22%)
leucine-rich repeat 337..362 CDD:275381 4/24 (17%)
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 12/42 (29%)
leucine-rich repeat 441..460 CDD:275381 3/18 (17%)
AMN1 <451..595 CDD:187754 40/193 (21%)
leucine-rich repeat 476..501 CDD:275381 6/46 (13%)
leucine-rich repeat 502..521 CDD:275381 6/20 (30%)
leucine-rich repeat 528..555 CDD:275381 8/26 (31%)
leucine-rich repeat 556..581 CDD:275381 6/25 (24%)
AMN1 577..746 CDD:187754 38/156 (24%)
leucine-rich repeat 582..607 CDD:275381 6/28 (21%)
leucine-rich repeat 608..633 CDD:275381 4/24 (17%)
leucine-rich repeat 634..659 CDD:275381 10/26 (38%)
leucine-rich repeat 660..685 CDD:275381 5/24 (21%)
leucine-rich repeat 686..710 CDD:275381 4/24 (17%)
leucine-rich repeat 711..735 CDD:275381 5/15 (33%)
leucine-rich repeat 737..761 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457925
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.