DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Skp2

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster


Alignment Length:337 Identity:70/337 - (20%)
Similarity:132/337 - (39%) Gaps:95/337 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DFFWLDVLKQLDLKSRISFAASCDMF------ENIYVR-SSPLRLSRVVNLEEMIEFSLLETKLF 70
            |...||:.|.|..|:.:..|..|..|      |.::.| ...||..|...||:::...:    |.
  Fly   244 DEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDLGLRTIRPGALEQIVRRGV----LV 304

  Fly    71 VELSGSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTK------------VNEIALEGFQL-----T 118
            :.|:.:.|:.....|:|.:|.....::.|....:|:            :.:|:||..:|     .
  Fly   305 IRLAQTSIQEPAFAPYTEVFRTRLQYLDLSMASITRSSLLTLLSHCRQLKKISLENIELDDDICA 369

  Fly   119 QYKWFNAPE----TSFSNLTYVSLRRCQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLPT- 178
            :.....|.|    |..|.||..|:|         :..|.||.|.:|::.:.| |:...:.:|.| 
  Fly   370 EIAKNEALEAVNLTMASGLTSNSVR---------LMMESLTSLSSLNISWTD-LSADAVTALVTH 424

  Fly   179 ---SLLSLYITGCRNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEISIC 240
               :|:.|.|.|||     :::|.:.:..|::                    .||.|:.:::|.|
  Fly   425 ISPNLIRLNIAGCR-----RVLFDSHVATLQK--------------------RCPQLLELDLSDC 464

  Fly   241 SLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLIS-LLDVPFLRNLMFSDAPS-------G 297
            :            .|...||    |..::.|:.:::.:| ...:|..:.:.....||       |
  Fly   465 N------------SLTPTVI----TAIMKFKMLEYLSVSRCYLIPATKFIELKSMPSLTYLDIFG 513

  Fly   298 FVSANALSIISR 309
            .:|..|:.::.:
  Fly   514 MLSDTAMEVLEK 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 6/22 (27%)
leucine-rich repeat 157..179 CDD:275381 6/25 (24%)
leucine-rich repeat 180..204 CDD:275381 7/23 (30%)
leucine-rich repeat 205..231 CDD:275381 2/25 (8%)
leucine-rich repeat 232..285 CDD:275381 9/53 (17%)
leucine-rich repeat 286..326 CDD:275381 5/31 (16%)
AMN1 306..>376 CDD:187754 0/4 (0%)
leucine-rich repeat 337..362 CDD:275381
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 11/39 (28%)
leucine-rich repeat 302..327 CDD:275381 6/28 (21%)
AMN1 309..480 CDD:187754 44/221 (20%)
leucine-rich repeat 328..352 CDD:275381 2/23 (9%)
leucine-rich repeat 353..376 CDD:275381 4/22 (18%)
leucine-rich repeat 377..402 CDD:275381 9/33 (27%)
leucine-rich repeat 403..428 CDD:275381 6/25 (24%)
leucine-rich repeat 429..455 CDD:275381 9/50 (18%)
leucine-rich repeat 456..480 CDD:275381 7/39 (18%)
leucine-rich repeat 481..500 CDD:275381 2/18 (11%)
leucine-rich repeat 506..529 CDD:275381 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.