DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Ppa

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster


Alignment Length:294 Identity:66/294 - (22%)
Similarity:123/294 - (41%) Gaps:84/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LTYVSLRRC-QLNDE---NLVGWEFLT-----HLETLDL----RYNDRLTGSCLMSLPTSLLSLY 184
            |.:::||.| .::|:   :|.|:...|     .||.|.|    |.:|...|.....| |||.|:.
  Fly   315 LKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGL-TSLKSIN 378

  Fly   185 ITGCRNLCPNQLIFLNRIPRLRE--LRASD---------LMPGGHWHIYRDLVLACPLLVMVEIS 238
            ::.|.::..:.|..|.|:|:|.:  ||:.|         |..||..            :..:::|
  Fly   379 LSFCVSVTDSGLKHLARMPKLEQLNLRSCDNISDIGMAYLTEGGSG------------INSLDVS 431

  Fly   239 ICSLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANA 303
            .|....|:    .|.::...:.:..|....:|:::|..::.:                    |.|
  Fly   432 FCDKISDQ----ALTHIAQGLYRLRSLSLNQCQITDHGMLKI--------------------AKA 472

  Fly   304 LSIISRFRQLRVLKMPNQPYRPND--LLRL-RNLTFLETLDLSNSPYITNEVVIELVIGIP---- 361
            |      .:|..|.: .|..|..|  |..| .:||.|:|:||.....:::: .|::::.:|    
  Fly   473 L------HELENLNI-GQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSK-GIDIIMKLPKLQK 529

  Fly   362 -NLSVLIVQGCPLLTNRVYLDAE-LASKKRSNGN 393
             ||.:.:|:.|      |:.|.. .|:|:.:.|:
  Fly   530 LNLGLWLVRXC------VHHDCNACAAKEAARGS 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/31 (26%)
leucine-rich repeat 157..179 CDD:275381 8/25 (32%)
leucine-rich repeat 180..204 CDD:275381 6/23 (26%)
leucine-rich repeat 205..231 CDD:275381 7/36 (19%)
leucine-rich repeat 232..285 CDD:275381 7/52 (13%)
leucine-rich repeat 286..326 CDD:275381 7/39 (18%)
AMN1 306..>376 CDD:187754 19/77 (25%)
leucine-rich repeat 337..362 CDD:275381 6/29 (21%)
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754 5/18 (28%)
leucine-rich repeat 236..256 CDD:275381
leucine-rich repeat 263..288 CDD:275381
leucine-rich repeat 289..314 CDD:275381
leucine-rich repeat 315..347 CDD:275381 8/31 (26%)
AMN1 347..524 CDD:187754 48/221 (22%)
leucine-rich repeat 348..373 CDD:275381 8/25 (32%)
leucine-rich repeat 374..398 CDD:275381 6/23 (26%)
leucine-rich repeat 399..424 CDD:275381 7/24 (29%)
leucine-rich repeat 425..450 CDD:275381 4/28 (14%)
leucine-rich repeat 451..475 CDD:275381 6/49 (12%)
leucine-rich repeat 476..501 CDD:275381 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457937
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.