DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl2

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_038938600.1 Gene:Fbxl2 / 363156 RGDID:1562243 Length:439 Species:Rattus norvegicus


Alignment Length:403 Identity:93/403 - (23%)
Similarity:139/403 - (34%) Gaps:126/403 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IEFSLLETKLFVELSGSDIEIIRGGPHTPMFSHFEDFIRL-MSIRLTKV-NEIALEGFQLTQYKW 122
            :.||.|........:|||..|.....|.|....|.|.:.| ...:::|. |.:||:|....:...
  Rat     9 VAFSKLSPVSLRTRTGSDPRIDVSLVHGPRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRVDL 73

  Fly   123 FNAPETSFSN-------------LTYVSLRRC----------------QLNDENLVGW------- 151
            ||. :|....             |..:|||.|                .:...||.|.       
  Rat    74 FNF-QTDVEGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDST 137

  Fly   152 -----EFLTHLETLDLRYNDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLNRIPR------- 204
                 .|.:.|:.|||.       || :|:..|.|.....|||||....|.:.::|.:       
  Rat   138 CYSLSRFCSKLKHLDLT-------SC-VSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALV 194

  Fly   205 --LRELRA------SDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELRY------L 255
              .|.|:|      :.|......||...    |..||.:.:..||...|:   |.::.      |
  Rat   195 RGCRGLKALLLRGCTQLEDEALKHIQNH----CHELVSLNLQSCSRITDD---GVVQICRGCHRL 252

  Fly   256 QSLVIKAHSTDTIRCKVSDWMLISL-LDVPFLRNL------MFSDAPSGFVSANALSIISRFRQL 313
            |:|.:...|      .::|..|.:| |:.|.|:.|      ..:||  ||.              
  Rat   253 QALCLSGCS------NLTDASLTALGLNCPRLQVLEAARCSHLTDA--GFT-------------- 295

  Fly   314 RVLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLLTNR- 377
                           |..||...||.:||.....||:..:|:|.|..|.|..|.:..|.|:|:. 
  Rat   296 ---------------LLARNCHDLEKMDLEECVLITDSTLIQLSIHCPKLQALSLSHCELITDEG 345

  Fly   378 -VYLDAELASKKR 389
             ::|.:.....:|
  Rat   346 ILHLSSSTCGHER 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 9/50 (18%)
leucine-rich repeat 157..179 CDD:275381 7/21 (33%)
leucine-rich repeat 180..204 CDD:275381 8/23 (35%)
leucine-rich repeat 205..231 CDD:275381 7/31 (23%)
leucine-rich repeat 232..285 CDD:275381 14/59 (24%)
leucine-rich repeat 286..326 CDD:275381 6/45 (13%)
AMN1 306..>376 CDD:187754 17/69 (25%)
leucine-rich repeat 337..362 CDD:275381 9/24 (38%)
Fbxl2XP_038938600.1 F-box-like <38..72 CDD:403981 8/33 (24%)
leucine-rich repeat 68..95 CDD:275381 3/27 (11%)
AMN1 <92..239 CDD:187754 36/158 (23%)
leucine-rich repeat 96..115 CDD:275381 5/18 (28%)
leucine-rich repeat 122..147 CDD:275381 4/24 (17%)
leucine-rich repeat 148..173 CDD:275381 11/32 (34%)
leucine-rich repeat 174..199 CDD:275381 3/24 (13%)
AMN1 184..383 CDD:187754 49/219 (22%)
leucine-rich repeat 200..225 CDD:275381 6/28 (21%)
leucine-rich repeat 226..251 CDD:275381 6/27 (22%)
leucine-rich repeat 252..277 CDD:275381 8/30 (27%)
leucine-rich repeat 278..303 CDD:275381 9/55 (16%)
leucine-rich repeat 304..329 CDD:275381 9/24 (38%)
leucine-rich repeat 330..352 CDD:275381 6/21 (29%)
leucine-rich repeat 359..378 CDD:275381 93/403 (23%)
leucine-rich repeat 384..409 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.