DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl22

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001102239.1 Gene:Fbxl22 / 363083 RGDID:1311830 Length:236 Species:Rattus norvegicus


Alignment Length:158 Identity:41/158 - (25%)
Similarity:64/158 - (40%) Gaps:45/158 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 SICSLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSAN 302
            |:..|.:|.:||...  |:||.|..||:....|.:.||:                      .||.
  Rat    50 SLTELKKDNFRLSPA--LRSLSICWHSSRVQVCSIEDWL----------------------KSAF 90

  Fly   303 ALSIISRFRQLRVLKMPNQPYRPNDLL-----RLRNLTFLETLDLSNSPYITNEVVIELVIGIPN 362
            ..||.|:...|           .||.|     |..||.   ::.||...::|::.:..|::|.|.
  Rat    91 QRSICSQHENL-----------VNDFLLQVCNRCPNLA---SVTLSGCGHVTDDCLARLLLGCPR 141

  Fly   363 LSVLIVQGCPLLTNRVYLDAELASKKRS 390
            |..|.::.|..:|||..  |.:|:..|:
  Rat   142 LRALRLENCARVTNRTL--AAVAAHGRA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381
leucine-rich repeat 180..204 CDD:275381
leucine-rich repeat 205..231 CDD:275381
leucine-rich repeat 232..285 CDD:275381 14/46 (30%)
leucine-rich repeat 286..326 CDD:275381 6/39 (15%)
AMN1 306..>376 CDD:187754 18/74 (24%)
leucine-rich repeat 337..362 CDD:275381 5/24 (21%)
Fbxl22NP_001102239.1 F-box-like 3..43 CDD:403981
AMN1 44..>191 CDD:187754 41/158 (26%)
leucine-rich repeat 116..141 CDD:275381 6/27 (22%)
leucine-rich repeat 142..167 CDD:275381 8/26 (31%)
leucine-rich repeat 168..193 CDD:275381 41/158 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346600
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.