DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and CG9003

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster


Alignment Length:372 Identity:84/372 - (22%)
Similarity:139/372 - (37%) Gaps:102/372 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ETKLFVELSGSDIEIIRGGPHTPMFSHFEDFIRLMSI-RLTKV----NEIALEGFQLTQYKWF-- 123
            :::.|:..:..|.|:|:..|...:...| .::.::|: |..:|    |.:||:|....:...|  
  Fly   225 QSQTFLGATELDDELIKQLPKEVLLRVF-SYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDF 288

  Fly   124 ----------NAPETSFSNLTYVSLRRCQ-LNDENLVGWEFLTH-LETLDLRYNDRLTGSCLMSL 176
                      |..:.....|..:|||.|| :.|:::.......| :|.|||....::|.....|:
  Fly   289 QRDIEGPVIENISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSI 353

  Fly   177 P---TSLLSLYITGCRNLCPNQLIFL-NRIPRLRELRASDLMPGGHW-HIYRD-----LVLACPL 231
            .   :.|.::.:..|.|:..|.|.:| :..|.|.|:..|       | |:..:     |...|..
  Fly   354 SRYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVS-------WCHLISENGVEALARGCVK 411

  Fly   232 LVMVEISICSLNRDEYRLGELRYLQSL-VIKAHSTDTI---------------------RC-KVS 273
            |.......|....|...:...:|...| |:..||.:||                     :| .::
  Fly   412 LRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLT 476

  Fly   274 DWMLISL---------LDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDLL 329
            |..|:||         |:|...||  |:|.  ||   .||.                        
  Fly   477 DLTLLSLSQHNHLLNTLEVSGCRN--FTDI--GF---QALG------------------------ 510

  Fly   330 RLRNLTFLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLLTN 376
              ||..:||.:||.....||:..:..|..|.|:|..|.:..|.|:|:
  Fly   511 --RNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITD 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 7/23 (30%)
leucine-rich repeat 157..179 CDD:275381 6/24 (25%)
leucine-rich repeat 180..204 CDD:275381 6/24 (25%)
leucine-rich repeat 205..231 CDD:275381 7/31 (23%)
leucine-rich repeat 232..285 CDD:275381 17/84 (20%)
leucine-rich repeat 286..326 CDD:275381 8/39 (21%)
AMN1 306..>376 CDD:187754 15/69 (22%)
leucine-rich repeat 337..362 CDD:275381 8/24 (33%)
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 10/45 (22%)
leucine-rich repeat 280..307 CDD:275381 2/26 (8%)
AMN1 <308..453 CDD:187754 38/151 (25%)
leucine-rich repeat 308..327 CDD:275381 7/18 (39%)
leucine-rich repeat 334..359 CDD:275381 6/24 (25%)
leucine-rich repeat 360..385 CDD:275381 6/24 (25%)
leucine-rich repeat 386..411 CDD:275381 7/31 (23%)
AMN1 <409..586 CDD:187754 42/180 (23%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
leucine-rich repeat 438..463 CDD:275381 6/24 (25%)
leucine-rich repeat 464..515 CDD:275381 17/83 (20%)
leucine-rich repeat 516..541 CDD:275381 8/24 (33%)
leucine-rich repeat 542..561 CDD:275381 5/14 (36%)
leucine-rich repeat 571..595 CDD:275381
leucine-rich repeat 596..621 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457975
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.