DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and CG9316

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_610051.2 Gene:CG9316 / 35333 FlyBaseID:FBgn0032878 Length:448 Species:Drosophila melanogaster


Alignment Length:388 Identity:88/388 - (22%)
Similarity:130/388 - (33%) Gaps:124/388 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ISFAASCDMFENIYVRSSPLRLSRV----VNLEEMIEFSLLETKLFVELSGSDIEIIRGGPHTPM 89
            ||::.:.|.|....:.|....|.||    ::.|:::.|.:...:                     
  Fly   142 ISYSNATDEFHYRSIMSKMTHLKRVTIECLDAEDVLNFDMQPNQ--------------------- 185

  Fly    90 FSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRCQLNDENLVGW--- 151
                                 .||.|:|....:.......|.||..:.||.|.|       |   
  Fly   186 ---------------------ELEFFELVNGCYTGQNLCGFPNLKTLVLRDCLL-------WNSM 222

  Fly   152 EF---LTHLETLDLRYNDRLTGSCLMSLPTSLLSLYITGCRNL-------CPNQLIFLNRIPRLR 206
            ||   |..|.|||      |...|...:..||.......|.||       |......:..:|:|.
  Fly   223 EFGIPLKSLHTLD------LDDCCFEVMNVSLYQKIAESCTNLVELIFSGCDTNFEVIANLPKLE 281

  Fly   207 ELRASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYL----QSLVIKAHSTDT 267
            .......|.....:|....|||                 |.|..:|.:|    |..:...|:   
  Fly   282 RCTLKTWMTSNELNIGFLTVLA-----------------EKRGNKLTHLHLSGQFNITNEHA--- 326

  Fly   268 IRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQL---RVLKMPNQPYRPNDLL 329
             ||.   ..|.||.|:.|..|.:..|  ..|...|.||.:.||...   ||:.:        .::
  Fly   327 -RCL---GQLSSLTDLRFSNNDILDD--DHFKFFNDLSQLERFGLTACGRVMDV--------GMM 377

  Fly   330 R-LRNLTFLETLDLSNSPYITNEVVIELVIGIPNLS-----VLIVQGC----PLLTNRVYLDA 382
            | ||....|:.:||::...||.|.||: .||..:..     ||.|:|.    |:||:..|:::
  Fly   378 RMLRKCPQLKVIDLTDCEQITEEFVIQ-AIGFCSKGSGRDVVLNVKGTMIRRPILTHPDYVNS 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 9/28 (32%)
leucine-rich repeat 157..179 CDD:275381 6/21 (29%)
leucine-rich repeat 180..204 CDD:275381 5/30 (17%)
leucine-rich repeat 205..231 CDD:275381 6/25 (24%)
leucine-rich repeat 232..285 CDD:275381 12/56 (21%)
leucine-rich repeat 286..326 CDD:275381 10/42 (24%)
AMN1 306..>376 CDD:187754 23/82 (28%)
leucine-rich repeat 337..362 CDD:275381 10/24 (42%)
CG9316NP_610051.2 leucine-rich repeat 208..221 CDD:275381 6/19 (32%)
leucine-rich repeat 231..258 CDD:275381 9/32 (28%)
leucine-rich repeat 259..279 CDD:275381 2/19 (11%)
leucine-rich repeat 280..309 CDD:275381 8/45 (18%)
AMN1 310..>411 CDD:187754 34/118 (29%)
leucine-rich repeat 310..334 CDD:275381 7/30 (23%)
leucine-rich repeat 335..359 CDD:275381 8/25 (32%)
leucine-rich repeat 360..385 CDD:275381 7/32 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457953
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.