DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and jet

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster


Alignment Length:234 Identity:50/234 - (21%)
Similarity:82/234 - (35%) Gaps:87/234 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 MVEISICSLNRDEYRLGELRYLQSLVIKAHSTDTI--------RC---------KVSDWMLISLL 281
            :..:..||.....:....|...|.|.:..::|..|        ||         ....|:...||
  Fly    63 LFNLRCCSRTAQRFVEAALEKRQELHLSGNNTKNIDVAFRVLARCCQRLEVLHLACCRWLTDELL 127

  Fly   282 DVPFLRN---LMFSDAPSGFVSANALS---IISRFRQLRVLKMPNQPYRPN---DLLRL------ 331
             :|.|.|   .:::...:..|:..|||   ||...::|||||:....:...   |.|.|      
  Fly   128 -LPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKLSKCQWLTTGAVDALTLHQSKLV 191

  Fly   332 -------------------RNLTFLETLDLSNSPYITNEVVIEL-----------VIGIPNLS-- 364
                               |.|..|..|.|:|:|.:|::|:|::           |||...:|  
  Fly   192 EFDISYCGAIGERCLIIFFRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDY 256

  Fly   365 -------------VLIVQGCPLLT---------NRVYLD 381
                         .|:::.||.:|         .|:|:|
  Fly   257 GVHALTVHCLRLRTLLIRRCPRVTELSLAPLRQRRLYID 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381
leucine-rich repeat 180..204 CDD:275381
leucine-rich repeat 205..231 CDD:275381
leucine-rich repeat 232..285 CDD:275381 12/67 (18%)
leucine-rich repeat 286..326 CDD:275381 13/45 (29%)
AMN1 306..>376 CDD:187754 28/132 (21%)
leucine-rich repeat 337..362 CDD:275381 11/35 (31%)
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 6/24 (25%)
AMN1 96..>261 CDD:187754 37/165 (22%)
leucine-rich repeat 111..137 CDD:275381 6/26 (23%)
leucine-rich repeat 138..163 CDD:275381 6/24 (25%)
leucine-rich repeat 164..189 CDD:275381 8/24 (33%)
leucine-rich repeat 190..215 CDD:275381 2/24 (8%)
leucine-rich repeat 216..241 CDD:275381 8/24 (33%)
leucine-rich repeat 242..267 CDD:275381 4/24 (17%)
leucine-rich repeat 268..290 CDD:275381 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.