DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and fbxl14a

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_958890.1 Gene:fbxl14a / 333988 ZFINID:ZDB-GENE-030131-5920 Length:411 Species:Danio rerio


Alignment Length:406 Identity:84/406 - (20%)
Similarity:148/406 - (36%) Gaps:96/406 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VLKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVNLEEMIEFSLLETKLFVELSGSDIEIIRG 83
            :...||:|.:...|..|..:.:.....|..|     .:|..:........||..|....|:    
Zfish    16 IFNYLDVKGKGRVAQVCTAWRDASYHKSVWR-----GVEAKLHLRRANPSLFPSLQTRGIK---- 71

  Fly    84 GPHTPMFSHFEDFIRLMSIR---------LTKVNEIALEG-FQLTQYKWFNAPETSFSNLTYVSL 138
                        .::::|:|         :..:..:.|.| :.||.....:|......:|..::|
Zfish    72 ------------KVQILSLRRSLSYVIQGMPNIESLNLSGCYNLTDNGLGHAFVQDIPSLRILNL 124

  Fly   139 RRC-QLNDENLVG--WEFLTHLETLDLRYNDRLTGSCLMSLPTSLLSLYITGCRNLCPNQLIFLN 200
            ..| |:.|.:| |  .::|.:||.|||       |.|.....|.|| |...|..||         
Zfish   125 SLCKQITDSSL-GRIAQYLKNLELLDL-------GGCSNITNTGLL-LIAWGLHNL--------- 171

  Fly   201 RIPRLRELR-ASDLMPGGHWHIYRDLVLACPLLVMVEISIC------SLNRDEYRLGELRYLQ-- 256
            :...||..| .||:..|....:.|.....|..|..:.:..|      ||......|.:|:.|.  
Zfish   172 KSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLEHLTLQDCQKLTDLSLKHISKGLNKLKVLNLS 236

  Fly   257 --------SLVIKAHSTD--TIRCK----VSDWMLISL---------LDVPFLRNLMFSDAPSGF 298
                    .::..:|.|.  |:..:    :||..::.|         |||.|...          
Zfish   237 FCGGISDAGMIHLSHMTQLWTLNLRSCDNISDTGIMHLSMGALRLYGLDVSFCDK---------- 291

  Fly   299 VSANALSIISR-FRQLRVLKMPNQPYRPNDLLRL-RNLTFLETLDLSNSPYITNEVVIELVIGIP 361
            |...:|:.|:: ..||:.|.:.:.....:.:.|: |.:..|:||::.....||::.:..:...:.
Zfish   292 VGDQSLAYIAQGLYQLKSLSLCSCHISDDGINRMVRQMHELKTLNIGQCVRITDKGLELIADHLT 356

  Fly   362 NLSVLIVQGCPLLTNR 377
            .|:.:.:.||..:|.|
Zfish   357 QLTGIDLYGCTKITKR 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/25 (32%)
leucine-rich repeat 157..179 CDD:275381 7/21 (33%)
leucine-rich repeat 180..204 CDD:275381 6/23 (26%)
leucine-rich repeat 205..231 CDD:275381 8/26 (31%)
leucine-rich repeat 232..285 CDD:275381 16/83 (19%)
leucine-rich repeat 286..326 CDD:275381 6/40 (15%)
AMN1 306..>376 CDD:187754 14/71 (20%)
leucine-rich repeat 337..362 CDD:275381 5/24 (21%)
fbxl14aNP_958890.1 F-box-like 5..46 CDD:289689 6/29 (21%)
AMN1 90..243 CDD:187754 42/170 (25%)
leucine-rich repeat 92..118 CDD:275381 5/25 (20%)
leucine-rich repeat 119..144 CDD:275381 8/25 (32%)
leucine-rich repeat 145..170 CDD:275381 12/32 (38%)
leucine-rich repeat 171..203 CDD:275381 9/40 (23%)
leucine-rich repeat 204..229 CDD:275381 5/24 (21%)
AMN1 230..397 CDD:187754 30/153 (20%)
leucine-rich repeat 230..254 CDD:275381 3/23 (13%)
leucine-rich repeat 255..280 CDD:275381 4/24 (17%)
leucine-rich repeat 281..304 CDD:275381 7/32 (22%)
leucine-rich repeat 307..331 CDD:275381 4/23 (17%)
leucine-rich repeat 332..357 CDD:275381 5/24 (21%)
leucine-rich repeat 358..377 CDD:275381 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.