DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl13

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_011248071.1 Gene:Fbxl13 / 320118 MGIID:2443416 Length:889 Species:Mus musculus


Alignment Length:431 Identity:88/431 - (20%)
Similarity:154/431 - (35%) Gaps:136/431 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFISFSVISRFDFFWLDVLKQLDLKSRISFAASCDMFENIYV------RSSPLRLS------RV 53
            :.|......||.:..|:.::::..|.:.|.|:...::.:...|      |.:.|||:      |.
Mouse   255 LTFKDMMACSRVNRSWMAMIQRGSLWNSIDFSTVKNIADKCVVTTLQKWRLNVLRLNFRGCDFRT 319

  Fly    54 VNLEEMIEFSLLETKLFVELSGSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLT 118
            ..|:     ::...|...||:.||.:           |..::.:|.:|           ||....
Mouse   320 KTLK-----AVSHCKNLQELNVSDCQ-----------SFTDESMRHIS-----------EGCPGV 357

  Fly   119 QYKWFNAPETSFSNLTYVSLRRCQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLPT----- 178
            .|  .|...|:.:|.|...|.|            :..:|:.|.|.|..:.|...|..|..     
Mouse   358 LY--LNLSNTTITNRTMRLLPR------------YFHNLQNLSLAYCRKFTDKGLQYLNLGNGCH 408

  Fly   179 SLLSLYITGC--------RNL---CPNQL-IFLNRIPRLRELRASDLMPGGHWHIYRDLVLACPL 231
            .|:.|.::||        ||:   |...: :.:|.:|.|.:            :..:.||..||.
Mouse   409 KLIYLDLSGCTQISVQGFRNIASSCTGIVHLTINDMPTLTD------------NCVKVLVEKCPR 461

  Fly   232 LVMV--------------EISICSLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISL-L 281
            :..|              .:|.|.|.:..:. |..|                  :||....|: .
Mouse   462 ISSVVLIGSPHISDSAFKALSSCDLKKIRFE-GNKR------------------ISDACFKSIDR 507

  Fly   282 DVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPNQPYRPNDL-----------LRLRNLT 335
            :.|.:.::...|...  ::.::|..:|..:||.||.:.| ..|..|:           :|||.  
Mouse   508 NYPGINHIYMVDCKG--LTDSSLKSLSLLKQLTVLNLTN-CIRIGDIGLKHFFDGPASIRLRE-- 567

  Fly   336 FLETLDLSNSPYITNEVVIELVIGIPNLSVLIVQGCPLLTN 376
                |:|:|...:.:..||.|....|||..|.::.|..||:
Mouse   568 ----LNLTNCSLLGDSSVIRLSERCPNLHYLNLRNCEHLTD 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 3/22 (14%)
leucine-rich repeat 157..179 CDD:275381 7/26 (27%)
leucine-rich repeat 180..204 CDD:275381 8/35 (23%)
leucine-rich repeat 205..231 CDD:275381 4/25 (16%)
leucine-rich repeat 232..285 CDD:275381 9/67 (13%)
leucine-rich repeat 286..326 CDD:275381 9/39 (23%)
AMN1 306..>376 CDD:187754 23/80 (29%)
leucine-rich repeat 337..362 CDD:275381 6/24 (25%)
Fbxl13XP_011248071.1 F-box-like 240..284 CDD:372399 5/28 (18%)
leucine-rich repeat 255..268 CDD:275381 3/12 (25%)
leucine-rich repeat 280..306 CDD:275381 4/25 (16%)
AMN1 306..475 CDD:187754 44/221 (20%)
leucine-rich repeat 307..330 CDD:275381 5/27 (19%)
leucine-rich repeat 331..356 CDD:275381 9/46 (20%)
leucine-rich repeat 357..381 CDD:275381 7/37 (19%)
leucine-rich repeat 382..409 CDD:275381 7/26 (27%)
leucine-rich repeat 410..435 CDD:275381 7/24 (29%)
leucine-rich repeat 436..461 CDD:275381 6/36 (17%)
leucine-rich repeat 462..484 CDD:275381 2/21 (10%)
AMN1 473..605 CDD:187754 35/160 (22%)
leucine-rich repeat 486..511 CDD:275381 6/43 (14%)
leucine-rich repeat 512..536 CDD:275381 3/25 (12%)
leucine-rich repeat 537..564 CDD:275381 6/27 (22%)
leucine-rich repeat 565..590 CDD:275381 8/30 (27%)
leucine-rich repeat 591..610 CDD:275381 5/14 (36%)
leucine-rich repeat 617..645 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843163
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.