DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl17

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_038939705.1 Gene:Fbxl17 / 316663 RGDID:1309773 Length:739 Species:Rattus norvegicus


Alignment Length:288 Identity:62/288 - (21%)
Similarity:102/288 - (35%) Gaps:100/288 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 FSNLTYVSLRRCQLNDENLVG-------WEFL----THLETLDLRYNDRLTGSCLMSLPT---SL 180
            ||||:.         ||..:.       |..|    ...:.|||....::|...|..:.:   ::
  Rat   328 FSNLSL---------DERCLSASLVCKYWRDLCLDFQFWKQLDLSSRQQVTDELLEKIASRSQNI 383

  Fly   181 LSLYITGCRNL-----------CPNQLIFLNRIPRLRELRASD---LMPGGHWHIYRDLVLACPL 231
            :.:.|:.||::           ||..|    |....|..:.||   :....|          |||
  Rat   384 VEINISDCRSMSDSGVCVLAFKCPGLL----RYTAYRCKQLSDTSIIAVASH----------CPL 434

  Fly   232 LVMVEISICSLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPS 296
            |..|.:.    |:|:.....|:.|.|           :|:       .|.|:.|.:....||...
  Rat   435 LQKVHVG----NQDKLTDEGLKQLGS-----------KCR-------ELKDIHFGQCYKISDEGM 477

  Fly   297 GFVSANALSIISRFRQLRVLKMPNQPYR------PN-----------------DLLRLRNLTFLE 338
            ..::.:.|.:...:.|...| :.:|..:      |:                 .|.:||||:   
  Rat   478 VVIAKSCLKLQRIYMQENKL-VTDQSVKAFAEHCPDLQCVGFMGCSVTSKGVIHLTKLRNLS--- 538

  Fly   339 TLDLSNSPYITNEVVIELVIGIPNLSVL 366
            :|||.:...:.||.|:|:|....|||.|
  Rat   539 SLDLRHITELDNETVMEIVKRCKNLSSL 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 5/33 (15%)
leucine-rich repeat 157..179 CDD:275381 5/24 (21%)
leucine-rich repeat 180..204 CDD:275381 7/34 (21%)
leucine-rich repeat 205..231 CDD:275381 5/28 (18%)
leucine-rich repeat 232..285 CDD:275381 10/52 (19%)
leucine-rich repeat 286..326 CDD:275381 6/45 (13%)
AMN1 306..>376 CDD:187754 21/84 (25%)
leucine-rich repeat 337..362 CDD:275381 8/24 (33%)
Fbxl17XP_038939705.1 F-box-like 316..361 CDD:403981 8/41 (20%)
leucine-rich repeat 357..382 CDD:275381 5/24 (21%)
leucine-rich repeat 383..408 CDD:275381 4/24 (17%)
AMN1 406..568 CDD:187754 46/201 (23%)
leucine-rich repeat 409..434 CDD:275381 7/38 (18%)
leucine-rich repeat 435..460 CDD:275381 8/46 (17%)
leucine-rich repeat 461..486 CDD:275381 5/24 (21%)
leucine-rich repeat 487..512 CDD:275381 3/25 (12%)
leucine-rich repeat 513..536 CDD:275381 2/22 (9%)
leucine-rich repeat 537..562 CDD:275381 9/27 (33%)
leucine-rich repeat 563..588 CDD:275381 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346639
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.