DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl12

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_006242701.1 Gene:Fbxl12 / 313782 RGDID:1305528 Length:326 Species:Rattus norvegicus


Alignment Length:386 Identity:75/386 - (19%)
Similarity:121/386 - (31%) Gaps:131/386 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DFFWLDVLKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVN---LEEMIEFSLLETK------ 68
            |...|::...|.::.||..:..|.            |..|:|:   |...::.:|...:      
  Rat     9 DLVLLEIFSYLPVRDRIRISRVCH------------RWKRLVDDRWLWRHVDLTLYTMRPKVMWH 61

  Fly    69 LFVELSGSDIEIIR------GGPHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPE 127
            |......|.:..:|      .|...|..|  ...:|.:..:...:..:.|....|:.....:.|.
  Rat    62 LLRRYMASRLHSLRMGGYLFSGSQAPQLS--PALMRALGQKCPNLKRLCLHVADLSMVPITSLPS 124

  Fly   128 TSFSNLTYVSLRRCQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSL--------PTSLLSLY 184
            |                            |.||:|.       ||.:|:        ||.|..| 
  Rat   125 T----------------------------LRTLELH-------SCEISMIWLQKEQDPTVLPLL- 153

  Fly   185 ITGCRNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRL 249
                      :.|.|:|:|..|:.....|.   .:...|.|||.....| .|..:.|      .|
  Rat   154 ----------ECIVLDRVPAFRDEHLQGLT---RFRALRSLVLGGTYRV-TETGLDS------SL 198

  Fly   250 GELRYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLR 314
            .||.|||.|       :.:.|.:|                         ..:..|:|....|.:|
  Rat   199 QELSYLQRL-------EVLGCTLS-------------------------ADSTLLAISRHLRDVR 231

  Fly   315 VLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEV-----VIELVIGIPNLSVLIVQG 370
            .:::.........|:.|..:..||:| ....|.||.|:     ::...:.:|.|.||.|||
  Rat   232 KIRLTVGGLSAQGLVFLEGMPVLESL-CFQGPLITPEMPTPAQIVSSCLTMPKLRVLEVQG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 0/22 (0%)
leucine-rich repeat 157..179 CDD:275381 8/29 (28%)
leucine-rich repeat 180..204 CDD:275381 5/23 (22%)
leucine-rich repeat 205..231 CDD:275381 6/25 (24%)
leucine-rich repeat 232..285 CDD:275381 12/52 (23%)
leucine-rich repeat 286..326 CDD:275381 4/39 (10%)
AMN1 306..>376 CDD:187754 19/70 (27%)
leucine-rich repeat 337..362 CDD:275381 7/29 (24%)
Fbxl12XP_006242701.1 F-box-like 4..48 CDD:403981 10/50 (20%)
leucine-rich repeat 104..125 CDD:275381 3/20 (15%)
AMN1 121..>226 CDD:187754 37/192 (19%)
leucine-rich repeat 126..152 CDD:275381 10/32 (31%)
leucine-rich repeat 153..177 CDD:275381 7/37 (19%)
leucine-rich repeat 178..203 CDD:275381 10/31 (32%)
leucine-rich repeat 204..229 CDD:275381 7/56 (13%)
leucine-rich repeat 230..253 CDD:275381 3/22 (14%)
leucine-rich repeat 254..283 CDD:275381 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.