DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl15

DIOPT Version :10

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001101073.1 Gene:Fbxl15 / 309453 RGDID:1306444 Length:300 Species:Rattus norvegicus


Alignment Length:215 Identity:48/215 - (22%)
Similarity:78/215 - (36%) Gaps:49/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LRLSRVVN-LEEMIEFSLLETKLFVELSGSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTK----V 107
            |||.||.. ...:::..|...:.|        :..:.||..|         |...:||.:    :
  Rat    42 LRLQRVSRAFRALVQLHLARLRRF--------DAAQVGPQIP---------RAALVRLLRDAEGL 89

  Fly   108 NEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRCQLNDENLVGW------------EFLTHLETL 160
            .|:||    ...::|.     ...:|..|..|..||....|.|.            |....|:.:
  Rat    90 QELAL----APCHEWL-----LDEDLVPVLARNPQLRSVALAGCGQLSRRALGALAEGCPRLQRI 145

  Fly   161 DLRYNDRLTGSCLMSLP---TSLLSLYITGCRNLCPNQLIFL--NRIPRLRELRASDLMPGGHWH 220
            .|.:.|.:.|..|..|.   .:|..|.:|.||.|....:::|  .|...||.|..:.....|...
  Rat   146 SLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDTA 210

  Fly   221 IYRDLVLACPLLVMVEISIC 240
            : ::|...||.|..::::.|
  Rat   211 V-QELARNCPQLEHLDLTGC 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/34 (24%)
leucine-rich repeat 157..179 CDD:275381 6/24 (25%)
leucine-rich repeat 180..204 CDD:275381 8/25 (32%)
leucine-rich repeat 205..231 CDD:275381 6/25 (24%)
leucine-rich repeat 232..285 CDD:275381 2/9 (22%)
leucine-rich repeat 286..326 CDD:275381
AMN1 306..>376 CDD:187754
leucine-rich repeat 337..362 CDD:275381
Fbxl15NP_001101073.1 F-box_FBXL15 19..62 CDD:438898 6/19 (32%)
leucine-rich repeat 62..88 CDD:275381 7/42 (17%)
FBXL3_LRR-like <71..146 CDD:480268 19/92 (21%)
leucine-rich repeat 89..115 CDD:275381 7/34 (21%)
Interaction with SMURF1. /evidence=ECO:0000250 113..269 28/118 (24%)
leucine-rich repeat 116..141 CDD:275381 4/24 (17%)
AMN1 <139..>268 CDD:187754 23/92 (25%)
leucine-rich repeat 142..167 CDD:275381 6/24 (25%)
leucine-rich repeat 168..194 CDD:275381 8/25 (32%)
leucine-rich repeat 195..220 CDD:275381 6/25 (24%)
leucine-rich repeat 221..245 CDD:275381 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.