DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl19

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_006230338.1 Gene:Fbxl19 / 308999 RGDID:1310989 Length:739 Species:Rattus norvegicus


Alignment Length:229 Identity:54/229 - (23%)
Similarity:80/229 - (34%) Gaps:85/229 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISFSVISRFDFFW----LDVLKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVNLE--EMIEF 62
            :|::.:|:....|    |..|::|.|       :.|.......:.|:||...|:::|.  |.::.
  Rat   535 LSWTGVSKKQLMWLLNRLQGLQELVL-------SGCSWLSVSALGSAPLPALRLLDLRWIEDVKD 592

  Fly    63 SLLETKLFVELSGSDIEIIRGGPHT-PMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAP 126
            |.|.            |::...|.| |..:....       ||..|.|:.|.|.:||.       
  Rat   593 SQLR------------ELLLPPPDTKPGQTESRG-------RLQGVAELRLAGLELTD------- 631

  Fly   127 ETSFSNLTYVSLRRCQLNDENLVGWEFLTH---LETLDLRYNDRLTGSC---------LMSLPTS 179
                     .|||.            .|.|   |..|||.:       |         |::.|||
  Rat   632 ---------ASLRL------------LLRHAPQLSALDLSH-------CAHVGDPSVHLLTAPTS 668

  Fly   180 -----LLSLYITGCRNLCPNQLIFLNRIPRLREL 208
                 |:.|.:.||..|..:.|....|.||||.|
  Rat   669 PLRETLVHLNLAGCHRLTDHCLPLFRRCPRLRRL 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 4/22 (18%)
leucine-rich repeat 157..179 CDD:275381 7/30 (23%)
leucine-rich repeat 180..204 CDD:275381 7/23 (30%)
leucine-rich repeat 205..231 CDD:275381 3/4 (75%)
leucine-rich repeat 232..285 CDD:275381
leucine-rich repeat 286..326 CDD:275381
AMN1 306..>376 CDD:187754
leucine-rich repeat 337..362 CDD:275381
Fbxl19XP_006230338.1 zf-CXXC <95..122 CDD:251032
PHD_FXL19 132..193 CDD:277115
F-box-like 469..512 CDD:289689
AMN1 511..710 CDD:187754 54/229 (24%)
leucine-rich repeat 531..554 CDD:275381 4/18 (22%)
leucine-rich repeat 555..578 CDD:275381 7/29 (24%)
leucine-rich repeat 616..643 CDD:275381 12/54 (22%)
leucine-rich repeat 644..670 CDD:275381 9/32 (28%)
leucine-rich repeat 674..698 CDD:275381 7/23 (30%)
leucine-rich repeat 699..723 CDD:275381 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.