Sequence 1: | NP_573291.1 | Gene: | CG15056 / 32824 | FlyBaseID: | FBgn0030918 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006230338.1 | Gene: | Fbxl19 / 308999 | RGDID: | 1310989 | Length: | 739 | Species: | Rattus norvegicus |
Alignment Length: | 229 | Identity: | 54/229 - (23%) |
---|---|---|---|
Similarity: | 80/229 - (34%) | Gaps: | 85/229 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 ISFSVISRFDFFW----LDVLKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVNLE--EMIEF 62
Fly 63 SLLETKLFVELSGSDIEIIRGGPHT-PMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAP 126
Fly 127 ETSFSNLTYVSLRRCQLNDENLVGWEFLTH---LETLDLRYNDRLTGSC---------LMSLPTS 179
Fly 180 -----LLSLYITGCRNLCPNQLIFLNRIPRLREL 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15056 | NP_573291.1 | leucine-rich repeat | 133..156 | CDD:275381 | 4/22 (18%) |
leucine-rich repeat | 157..179 | CDD:275381 | 7/30 (23%) | ||
leucine-rich repeat | 180..204 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 205..231 | CDD:275381 | 3/4 (75%) | ||
leucine-rich repeat | 232..285 | CDD:275381 | |||
leucine-rich repeat | 286..326 | CDD:275381 | |||
AMN1 | 306..>376 | CDD:187754 | |||
leucine-rich repeat | 337..362 | CDD:275381 | |||
Fbxl19 | XP_006230338.1 | zf-CXXC | <95..122 | CDD:251032 | |
PHD_FXL19 | 132..193 | CDD:277115 | |||
F-box-like | 469..512 | CDD:289689 | |||
AMN1 | 511..710 | CDD:187754 | 54/229 (24%) | ||
leucine-rich repeat | 531..554 | CDD:275381 | 4/18 (22%) | ||
leucine-rich repeat | 555..578 | CDD:275381 | 7/29 (24%) | ||
leucine-rich repeat | 616..643 | CDD:275381 | 12/54 (22%) | ||
leucine-rich repeat | 644..670 | CDD:275381 | 9/32 (28%) | ||
leucine-rich repeat | 674..698 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 699..723 | CDD:275381 | 3/4 (75%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166346679 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |