DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15056 and Kdm2b

DIOPT Version :9

Sequence 1:	NP_573291.1	Gene:	CG15056 / 32824	FlyBaseID:	FBgn0030918	Length:	399	Species:	Drosophila melanogaster
Sequence 2:	XP_011246510.1	Gene:	Kdm2b / 30841	MGIID:	1354737	Length:	1312	Species:	Mus musculus

Alignment Length:	188	Identity:	44/188 - (23%)
Similarity:	68/188 - (36%)	Gaps:	80/188 - (42%)

- Green bases have known domain annotations that are detailed below.

  Fly   190 NLCPNQLIFL-NRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEIS-ICSLNRDEYRLGEL 252
            |:...||.:| ||:|.||:|    ::.|..|               :.:| :||
Mouse  1111 NISKKQLSWLINRLPGLRDL----VLSGCSW---------------IAVSALCS----------- 1145

  Fly   253 RYLQSLVIKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLK 317
                                |...|:..|||.::..|  .||                 |:|.|.
Mouse  1146 --------------------SSCPLLRTLDVQWVEGL--KDA-----------------QMRDLL 1171

  Fly   318 MP---NQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIELVI-GIPNLSVLIVQGC 371
            .|   |:|.:.::..:|||:..|....|.    || :|.:.|:| .:|.||.|.:..|
Mouse  1172 SPPTDNRPGQMDNRSKLRNIVELRLAGLD----IT-DVSLRLIIRHMPLLSKLQLSYC 1224

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15056	NP_573291.1	leucine-rich repeat	133..156	CDD:275381
		leucine-rich repeat	157..179	CDD:275381
		leucine-rich repeat	180..204	CDD:275381	6/14 (43%)
		leucine-rich repeat	205..231	CDD:275381	5/25 (20%)
		leucine-rich repeat	232..285	CDD:275381	8/53 (15%)
		leucine-rich repeat	286..326	CDD:275381	9/42 (21%)
		AMN1	306..>376	CDD:187754	21/70 (30%)
		leucine-rich repeat	337..362	CDD:275381	7/25 (28%)
Kdm2b	XP_011246510.1	JmjC	151..226	CDD:214721
		cupin_like	198..297	CDD:389752
		JHD	303..>338	CDD:375347
		zf-CXXC	<588..624	CDD:366873
		PHD_KDM2B	634..695	CDD:277114
		PTZ00449	<693..995	CDD:185628
		F-box-like	1044..1082	CDD:372399
		leucine-rich repeat	1053..1075	CDD:275381
		leucine-rich repeat	1078..1102	CDD:275381
		AMN1	1083..1283	CDD:187754	44/188 (23%)
		leucine-rich repeat	1103..1126	CDD:275381	6/14 (43%)
		leucine-rich repeat	1127..1150	CDD:275381	9/72 (13%)
		leucine-rich repeat	1151..1190	CDD:275381	13/57 (23%)
		leucine-rich repeat	1191..1215	CDD:275381	7/28 (25%)
		leucine-rich repeat	1216..1245	CDD:275381	4/9 (44%)
		leucine-rich repeat	1246..1270	CDD:275381
		leucine-rich repeat	1271..1295	CDD:275381
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1947
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900