DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl21

DIOPT Version :10

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_038951543.1 Gene:Fbxl21 / 306750 RGDID:1305555 Length:460 Species:Rattus norvegicus


Alignment Length:233 Identity:46/233 - (19%)
Similarity:77/233 - (33%) Gaps:82/233 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 GSCLMSLPTSLLSLYITGCRNLCPNQLI--FLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLL 232
            |.|.....|.:||..:..  ...|:.:|  ....:|.:...|||                     
  Rat    51 GLCTSLRQTQMLSALLDW--GTLPHHVILRIFQYLPLVDRARAS--------------------- 92

  Fly   233 VMVEISIC-SLNR-----DEYRLGELRYLQSL--------------VIKAH-------------S 264
                 |:| |.|.     |.:|..|....||.              :||.|             |
  Rat    93 -----SVCRSWNEVFHIPDLWRKFEFELNQSATSYFKSTHPDLIQQIIKKHAAHLQYVSFKVDSS 152

  Fly   265 TDT-----------IRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKM 318
            |::           :.|.:....|||.....|: |:    ..|.||||..:..::. :.|..:|:
  Rat   153 TESAEAACHILSQLVNCSIQTLGLISTAKPSFM-NM----PKSHFVSALTVVFVNS-KSLSSIKI 211

  Fly   319 PNQPYRPNDL--LRLRNLTFLETLDLSNSPYITNEVVI 354
            .:.|.....|  |...|...|..|.:|:.|:::::.::
  Rat   212 EDTPVDDPSLKILVANNSDTLRLLKMSSCPHVSSDGIL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381 2/8 (25%)
leucine-rich repeat 180..204 CDD:275381 4/25 (16%)
leucine-rich repeat 205..231 CDD:275381 3/25 (12%)
leucine-rich repeat 232..285 CDD:275381 18/96 (19%)
leucine-rich repeat 286..326 CDD:275381 9/39 (23%)
AMN1 306..>376 CDD:187754 10/51 (20%)
leucine-rich repeat 337..362 CDD:275381 4/18 (22%)
Fbxl21XP_038951543.1 F-box_SF 66..108 CDD:459239 11/69 (16%)
FBXL21_LRR 111..460 CDD:467831 29/145 (20%)
leucine-rich repeat 206..231 CDD:275381 6/24 (25%)
leucine-rich repeat 232..257 CDD:275381 4/18 (22%)
leucine-rich repeat 258..283 CDD:275381
leucine-rich repeat 284..318 CDD:275381
leucine-rich repeat 329..365 CDD:275381
leucine-rich repeat 366..392 CDD:275381
leucine-rich repeat 393..418 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.