Sequence 1: | NP_573291.1 | Gene: | CG15056 / 32824 | FlyBaseID: | FBgn0030918 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038951543.1 | Gene: | Fbxl21 / 306750 | RGDID: | 1305555 | Length: | 460 | Species: | Rattus norvegicus |
Alignment Length: | 233 | Identity: | 46/233 - (19%) |
---|---|---|---|
Similarity: | 77/233 - (33%) | Gaps: | 82/233 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 170 GSCLMSLPTSLLSLYITGCRNLCPNQLI--FLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLL 232
Fly 233 VMVEISIC-SLNR-----DEYRLGELRYLQSL--------------VIKAH-------------S 264
Fly 265 TDT-----------IRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKM 318
Fly 319 PNQPYRPNDL--LRLRNLTFLETLDLSNSPYITNEVVI 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15056 | NP_573291.1 | leucine-rich repeat | 133..156 | CDD:275381 | |
leucine-rich repeat | 157..179 | CDD:275381 | 2/8 (25%) | ||
leucine-rich repeat | 180..204 | CDD:275381 | 4/25 (16%) | ||
leucine-rich repeat | 205..231 | CDD:275381 | 3/25 (12%) | ||
leucine-rich repeat | 232..285 | CDD:275381 | 18/96 (19%) | ||
leucine-rich repeat | 286..326 | CDD:275381 | 9/39 (23%) | ||
AMN1 | 306..>376 | CDD:187754 | 10/51 (20%) | ||
leucine-rich repeat | 337..362 | CDD:275381 | 4/18 (22%) | ||
Fbxl21 | XP_038951543.1 | F-box-like | 68..111 | CDD:403981 | 12/70 (17%) |
leucine-rich repeat | 206..231 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 232..257 | CDD:275381 | 4/18 (22%) | ||
leucine-rich repeat | 258..283 | CDD:275381 | |||
leucine-rich repeat | 284..318 | CDD:275381 | |||
leucine-rich repeat | 329..365 | CDD:275381 | |||
AMN1 | <359..>424 | CDD:187754 | |||
leucine-rich repeat | 366..392 | CDD:275381 | |||
leucine-rich repeat | 393..418 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166346659 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |