DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15056 and Fbxl21

DIOPT Version :9

Sequence 1:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_038951543.1 Gene:Fbxl21 / 306750 RGDID:1305555 Length:460 Species:Rattus norvegicus


Alignment Length:233 Identity:46/233 - (19%)
Similarity:77/233 - (33%) Gaps:82/233 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 GSCLMSLPTSLLSLYITGCRNLCPNQLI--FLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLL 232
            |.|.....|.:||..:..  ...|:.:|  ....:|.:...|||                     
  Rat    51 GLCTSLRQTQMLSALLDW--GTLPHHVILRIFQYLPLVDRARAS--------------------- 92

  Fly   233 VMVEISIC-SLNR-----DEYRLGELRYLQSL--------------VIKAH-------------S 264
                 |:| |.|.     |.:|..|....||.              :||.|             |
  Rat    93 -----SVCRSWNEVFHIPDLWRKFEFELNQSATSYFKSTHPDLIQQIIKKHAAHLQYVSFKVDSS 152

  Fly   265 TDT-----------IRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKM 318
            |::           :.|.:....|||.....|: |:    ..|.||||..:..::. :.|..:|:
  Rat   153 TESAEAACHILSQLVNCSIQTLGLISTAKPSFM-NM----PKSHFVSALTVVFVNS-KSLSSIKI 211

  Fly   319 PNQPYRPNDL--LRLRNLTFLETLDLSNSPYITNEVVI 354
            .:.|.....|  |...|...|..|.:|:.|:::::.::
  Rat   212 EDTPVDDPSLKILVANNSDTLRLLKMSSCPHVSSDGIL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381 2/8 (25%)
leucine-rich repeat 180..204 CDD:275381 4/25 (16%)
leucine-rich repeat 205..231 CDD:275381 3/25 (12%)
leucine-rich repeat 232..285 CDD:275381 18/96 (19%)
leucine-rich repeat 286..326 CDD:275381 9/39 (23%)
AMN1 306..>376 CDD:187754 10/51 (20%)
leucine-rich repeat 337..362 CDD:275381 4/18 (22%)
Fbxl21XP_038951543.1 F-box-like 68..111 CDD:403981 12/70 (17%)
leucine-rich repeat 206..231 CDD:275381 6/24 (25%)
leucine-rich repeat 232..257 CDD:275381 4/18 (22%)
leucine-rich repeat 258..283 CDD:275381
leucine-rich repeat 284..318 CDD:275381
leucine-rich repeat 329..365 CDD:275381
AMN1 <359..>424 CDD:187754
leucine-rich repeat 366..392 CDD:275381
leucine-rich repeat 393..418 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346659
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.